CAZyme Information: MGYG000001214_00191

Basic Information

• Species: Lancefieldella rimae
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Lancefieldella; Lancefieldella rimae
• CAZyme ID: MGYG000001214_00191
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345		38494	8.0389

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001214	1507037	MAG	Austria	Europe

• Gene Location: Start: 21809; End: 22846 Strand: +

Full Sequence      

MAATKVLRGVNLTGWLTLEPWVTPEPFARTATVDEVSLAAKLGKDEYAELVRAHRTSFIH
SEDFSRIAARGFNALRLPIPWYVFEPQNTPYQPCIDMVDRALEWAEEIGLHVIFVLAVNP
GLPDGQDSTPGGSPRTRISCEKSLEIIKKLAQRYAHRLGFFGIEVADEVQPRIRQGLRII
DGVPAHSLRNYYRRAYNIVRTVAGEDPVVILPDGGWPSGWRRFMSQQSYTNVWLDCHLDR
TPSSVDCSGPLGIQRVIDAKRSYLLQVSSGDLPVMVGKWSASLPTPDGSMTAEGRIALER
IYASGQLAAYRGCPAWFFQTWKTSAFLAGWDARVALASFERGMLN

Enzyme Prediction     

No EC number prediction in MGYG000001214_00191.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	54	323	2.9e-39	0.9602649006622517

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	6.30e-12	2	234	13	247	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	1.86e-05	62	282	28	239	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACV51516.1	3.75e-184	3	345	2	346
QOY61077.1	5.74e-146	7	344	6	346
ADK68544.1	1.65e-128	3	345	2	347
SDR87855.1	3.59e-120	5	344	4	346
AKT48931.1	1.61e-118	3	345	2	346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	9.91e-32	7	331	3	373	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	1.90e-31	7	331	3	373	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
3O6A_A	1.88e-19	5	323	12	366	F144Y/F258YDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1EQP_A	2.46e-19	5	323	7	361	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
3N9K_A	2.56e-19	5	323	12	366	F229A/E292SDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1CRV0	8.54e-37	4	338	39	398	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
B0XN12	2.33e-36	6	338	41	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
Q4WK60	1.68e-35	6	338	41	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
A1D4Q5	6.23e-35	6	338	41	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1
A2RAR6	1.61e-32	4	338	39	399	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001214_00191.