CAZyme Information: MGYG000001214_01295

Basic Information

• Species: Lancefieldella rimae
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Lancefieldella; Lancefieldella rimae
• CAZyme ID: MGYG000001214_01295
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase GmuD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465	MGYG000001214_102|CGC1	54378.25	5.2843

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001214	1507037	MAG	Austria	Europe

• Gene Location: Start: 899; End: 2296 Strand: +

Full Sequence      

MSYTLPKDFFFGAAMSGPQTEGMWQDGNKLPNLWDTWSNLDITAFYNRVGSYGGNDFSRR
HNEDFKLLKSLGLTSVRTSIQWSRLLDQDGNLNPEGERFYHKLFADAKEAGIEIFINLYH
FDMPEYLFKRGGWESREVVEAYAHYARLALRTFGKEIRYWFTFNEPIVEPEMRYTQGGWY
PFIKNYARARAVQYNISVAHALAVREYHAAKAEGFMLEDSRIGLINCFAPPYTKENPTEA
DLEALRMTDGVNIRWWLDLVTKGELPQDVIESLDKRGVKLPVRPEDKMILADAKVDWLGC
NYYHPERVQAPAKDTDENGIPNFADPYVWPDAEMNVSRGWEIYPQGLYDFAMKIRNEYPE
LEWFVSENGMGVEREYLKKDDSGTIQDEYRIDFVRRHLEWIAQAIADGAKCRGYHYWAVI
DNWSWANAFKNRYGFIEVDLENNYERRLKKSASWLRQVAMTHVVS

Enzyme Prediction     

EC	3.2.1.21	3.2.1.85	3.2.1.86

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	461	3.5e-122	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	6.60e-161	3	461	2	452	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	1.16e-112	1	462	1	451	Glycosyl hydrolase family 1.
PRK13511	PRK13511	6.14e-105	1	464	1	468	6-phospho-beta-galactosidase; Provisional
TIGR03356	BGL	5.57e-103	6	454	1	425	beta-galactosidase.
PRK09589	celA	5.61e-60	4	458	3	468	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACV50514.1	0.0	1	464	1	464
QUC04859.1	1.46e-284	15	464	1	450
AZH70290.1	5.59e-258	3	464	4	465
ATP54210.1	6.50e-257	3	464	4	465
BCV18986.1	4.29e-246	4	465	5	467

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B3K_A	4.06e-113	6	462	4	458	Family1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_A Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes]
5FOO_A	5.92e-113	6	462	5	459	6-phospho-beta-glucosidase[Streptococcus pyogenes M1 GAS],5FOO_B 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_C 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_D 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_E 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_F 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS]
5NAQ_A	2.64e-98	6	458	21	471	Crystalstructure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_B Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_C Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_D Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_E Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_F Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum]
5NAV_A	5.26e-98	6	458	21	471	Crystalstructure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_B Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_C Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_D Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_E Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_F Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum]
6Z1H_A	3.28e-91	2	458	8	444	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05508	4.35e-120	3	459	7	460	6-phospho-beta-glucosidase GmuD OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuD PE=1 SV=1
P11546	2.38e-79	1	464	1	467	6-phospho-beta-galactosidase OS=Lactococcus lactis subsp. lactis OX=1360 GN=lacG PE=1 SV=2
C1CEE7	6.62e-79	1	464	1	467	6-phospho-beta-galactosidase OS=Streptococcus pneumoniae (strain JJA) OX=488222 GN=lacG PE=3 SV=1
Q97QL9	1.31e-78	1	464	1	467	6-phospho-beta-galactosidase 2 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=lacG2 PE=3 SV=1
Q8DPP6	1.84e-78	1	464	1	467	6-phospho-beta-galactosidase 2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=lacG2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001214_01295.