CAZyme Information: MGYG000001217_00610

Basic Information

• Species: Firm-10 sp004552515
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; Firm-10; Firm-10 sp004552515
• CAZyme ID: MGYG000001217_00610
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
784		88110.31	5.0102

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001217	2504977	MAG	Austria	Europe

• Gene Location: Start: 4808; End: 7162 Strand: +

Full Sequence      

MFSTKFVSATRDYSTFEKMVPAPYLRKSFEIGALPTAASVTICGLGFYELYVNGTRITKG
LLAPYISNPDDILYYDRYDVKPLLKTGQNVIAVLLGNGMLNCPGGDIWDFQLARFRSAPK
VALAYEAESADGEKTVFEADETFRCAPSPIYYDDLRAGEYYDARREIPSWNLPDFDDSGW
TSALPAETPRGECRLCQAEPIVTTHELAPVSIRRAAIGKLPDTRKTLPVLPYADETEAAM
RGWLYDFGVNAAGLCRLKVRGHAGQKIVLQFGEALDENGDLDLRGMTFLPHCRNHRDIYI
CKGDGEEIYVPSFTYHGFRYCLVLGLEDVQATSELLTYQVMNSDLKVIGGFSCSDDVLNK
LYQATLVSDLANFYYFPTDCPHREKNGWTGDAALSAEQMLMNLTAENSYREWLNNIRASQ
LEDGRIPGIVPTTGWGFEWGNGPAWDCVLANLPFFIWRYRGDTAIIRENAAALMRYLTYI
MTRRDERGLIHIGLGDWVHTAHSNHPKAPLVLTDTIECMDISRKSAMMFAAADLEPERMY
AQAVYDALRAAARKYLIDPDTMTAYGCCQASQAMAIFYDLFDPAEKSAAMQVLLEMIEDN
DELMDVGMLAGRVLFRLLAQSGHADLAYRMIVTPRNPSYGNWIKKGATSLWEDLDDDEAP
ASLNHHMWGDISAFMIECIAGIQVNPCCVDPAEIRIHPHFIADLSHAEGRHRGVHGEIVS
AWKREGALIRLTLTVPEGYRGDILLDKDWQFDDGRRAKDLKSGEYVLLPRTMKDKYFKPE
RTAK

Enzyme Prediction     

No EC number prediction in MGYG000001217_00610.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	242	743	3.4e-122	0.9801587301587301
CBM67	19	185	1.4e-32	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.88e-68	349	679	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.16e-39	35	201	3	168	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.48e-24	243	340	8	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.74e-07	693	738	11	56	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94103.1	9.08e-155	17	775	138	884
AHF16194.1	1.75e-148	14	745	164	861
APO32478.1	7.34e-141	242	587	22	364
BBK91320.1	1.64e-136	21	745	144	847
QUT54420.1	4.00e-136	21	745	139	842

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	6.64e-98	22	747	176	900	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.13e-74	45	748	326	997	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	4.83e-56	26	773	135	869	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.34e-80	22	747	184	908	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	5.46e-74	45	748	326	997	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	2.96e-67	24	748	176	881	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	6.86e-62	24	765	172	906	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999970	0.000064	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001217_00610.