CAZyme Information: MGYG000001217_00824

Basic Information

• Species: Firm-10 sp004552515
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; Firm-10; Firm-10 sp004552515
• CAZyme ID: MGYG000001217_00824
• CAZy Family: GH5
• CAZyme Description: Endoglucanase C307

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
257		30629.73	5.0927

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001217	2504977	MAG	Austria	Europe

• Gene Location: Start: 7058; End: 7831 Strand: -

Full Sequence      

MLLACDIPEKVTLFDSTELQDRFVALWVEFERRFAGKPQVMFELLNEVRDINPDDWNNLV
ERTIRAIRVINPTRRIIVGGTCWNSPDTLDRLRVYDDENVIYTFHTYSPFEFTHQRGVLQ
AAPLYYNRAMPWPCDDIERYRDYHRLISGRDNVYAEFDRMDIDFIRHELRGAVAFVKAHP
DKILWCGEFGTIRHCEVTSRENWMRDVITVLRENDMPYCVWNYLSPPNDGNRFSLVDDDR
RQIVSERMLRVIRGEEA

Enzyme Prediction     

No EC number prediction in MGYG000001217_00824.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	9	223	2.4e-57	0.6869009584664537

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	7.24e-19	20	115	103	203	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45789.1	6.28e-107	5	255	112	363
AEV59739.1	2.23e-39	13	223	104	314
AOA60286.1	9.63e-39	9	252	104	340
BAJ62400.1	1.41e-38	9	223	104	320
BAA00793.1	1.85e-38	12	246	104	333

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	3.68e-39	12	246	104	333	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	1.01e-38	12	246	104	333	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
3AMC_A	2.44e-20	15	225	103	290	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
4U3A_A	7.56e-20	21	239	182	358	ChainA, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U3A_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405]
5BYW_A	1.51e-19	21	239	182	369	ChainA, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_C Chain C, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_D Chain D, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_E Chain E, Endoglucanase H [Acetivibrio thermocellus ATCC 27405]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3DJ77	3.71e-39	12	246	104	333	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P23340	3.71e-39	12	246	104	333	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
P0C2S3	2.82e-38	12	246	104	333	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
P16218	8.29e-19	21	239	433	609	Endoglucanase H OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celH PE=1 SV=1
P25472	3.24e-18	22	132	133	252	Endoglucanase D OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001217_00824.