CAZyme Information: MGYG000001217_01207

Basic Information

• Species: Firm-10 sp004552515
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; Firm-10; Firm-10 sp004552515
• CAZyme ID: MGYG000001217_01207
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
725		80967.88	4.914

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001217	2504977	MAG	Austria	Europe

• Gene Location: Start: 470; End: 2647 Strand: +

Full Sequence      

MKGKWITCAKSVETPLFRKTFTAGDFTKAVIDISGLGYFTLLVNGRHVTDELFTPALTNY
AERDLSRFAYPIHDTISCRVLYMSYDVTPLMRRGENTVEVIVGNGWYRQKERVCEEKELY
GESLIAAFDLTLTAPDGTQTLVSTDGSEEAFVYPILESNLFLGEVIDTRLFDEPLEKTPV
LVSDFAPVRFQKQTCPSDRVIRSLTPRLLGTAGGRLIYDAGENISGTIRLRVCGKRGDRL
TVRYAESLNEDGTLCFTSTGANYVCSSGRPQIQTDTFILNGREQDITTMFVFHGFRYFDI
EGDAALLEPMVDIIHTDLPVASSFSCDNALLNWLYDAYLRTQLDNVHGCVPSDCPHRERL
GYTGDGQCCAETAMLTLDARGLYDKWIEDILDCQDTESGHIQHTAPFMGGGGGPGGWGCA
VVIVPWQHYRRYGDREILRRTFPAMKKWLSYMIMHCEDGLMTHEEEGGWCLGDWAAPIKM
VLPEPFVNTCYLVKTLDIMSRVAQTLVDLSWHDYEAIKGSYKKALYDRYFDGKSYCGGVQ
AADAFAIWAELPESEHLLDGLCARYDALGDFDTGFLGTDILCEVLMNGGRGDLALRLMAS
ENAESGFNYMRSRGATTIYEYLNNDRASQNHPMFGACVRQLFTGLLGLHQRENTAGWTDV
IVEPLLTSLVKSASGHIMTPRGAVRVSFDVHRHSLYIDIPDGLTAALRLNGKEQPLPAGQ
HTFEI

Enzyme Prediction     

No EC number prediction in MGYG000001217_01207.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	211	709	6.3e-111	0.9920634920634921
CBM67	4	170	7.8e-16	0.8238636363636364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	5.76e-65	321	636	3	331	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	8.11e-29	24	170	1	132	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	5.47e-17	211	309	3	93	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	0.002	651	724	3	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97255.1	3.23e-195	3	725	6	724
BCJ98018.1	1.82e-152	5	713	127	862
QOY86540.1	8.10e-131	15	721	152	856
QUT50058.1	3.59e-121	11	723	158	874
QBE96295.1	2.16e-103	2	719	123	842

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.06e-64	15	700	177	889	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.92e-63	27	684	317	967	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	3.37e-55	17	725	134	865	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	2.15e-63	2	713	148	910	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	9.69e-63	27	684	317	967	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	4.60e-57	2	709	150	878	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	6.52e-54	11	725	166	910	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001217_01207.