CAZyme Information: MGYG000001218_00912

Basic Information

• Species: RUG11247 sp902767315
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; RUG11247; RUG11247 sp902767315
• CAZyme ID: MGYG000001218_00912
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
878	MGYG000001218_44|CGC1	98716.18	4.4782

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001218	2482002	MAG	Austria	Europe

• Gene Location: Start: 8417; End: 11053 Strand: -

Full Sequence      

MLQITQWTLDYGRVTPATRSHYTGEEHPVFGWAVRSDRDGGRQSACHAVVYRENDILWDS
GWVETAEQSIAYAGPALPEGVELGIALEIRDEAGEESAPYEDFFYNARVDWKAPWIGDSD
PVQERPTYFRRDFTVTKGLKDACLYVCGIGYQHVYLDGEDGLLDLEKLDPAFTDYIRQCQ
YVMYPDLADALKPGRHCLAAIVASGWRDNPGVNRLLNVNDGNVAEFMGQPCLTAMLRLTY
QDGREELIVTDETWQCGHGGYQFASVFDGTVYDAREDAPEWNLPDFKGNFRPAKLMEALV
ATRDCHGWNTAEEPAPYDAPVPTRMEPMLIPPIIEFESTAPMAVWSDGDAVMMDFGQNLA
GVVDVILPDELAPGQKLHLTFSEELTEDGKLFRDTLRGAKAEDFYIASGDERDLIDWQSD
FTYHGFRYARLEGLGAGFDAAEFVTAVQMHTDLDTRSTFRCGSALLTQIHKNSVETERGN
MHSILTDCPQRDERQGWMNDATVRFEATPYNFDIGRMFPKIVRDLMDMQTAEGAIGCTAP
FIFGGIPADPVCSSFLVAGYESMMHKGNRKVIADAFAAYEAWEACLLKNSTDHIVNYSYY
GDWAGPLYACVNPENGAPGTVSAVTPGEFMSTGYSYYNCVLLSRFAGWLNLPEKKQYYLD
LAQTIREAMLKKWYDPETCRMATGSQACQAFSLWLGILPPTDCQKAAQVMRDDLVNRNYD
FTTGNLCTRYLLDMLAKYGYENEALALLEKETCPSYGFMIQQEATTIWERFELMTDATMN
SHNHPMYGAVDYWFYACLAGVRPLTPGWTEFEVAPVMPEKLQFAQAVVDTCKGEVNVRWV
RRYGGIHLQVTVPFGCTALVRFGGREHRVSAGFHTFHA

Enzyme Prediction     

No EC number prediction in MGYG000001218_00912.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	349	861	1.6e-131	0.9841269841269841
CBM67	114	287	3.6e-20	0.8863636363636364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.45e-77	457	798	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.01e-27	137	330	1	170	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.12e-21	349	450	6	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.84e-14	800	860	1	61	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA22854.1	4.04e-153	28	860	53	849
AEF82974.1	1.26e-148	26	864	29	845
VEH16339.1	9.02e-147	28	860	52	851
QEC51112.1	7.40e-131	28	860	90	893
AHF90970.1	3.20e-129	28	860	27	842

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	3.15e-120	25	853	48	889	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	7.03e-81	111	860	287	992	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	4.94e-64	24	877	19	864	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF03	2.94e-88	25	858	48	874	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	1.95e-84	28	858	55	874	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	3.30e-80	111	860	287	992	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	3.61e-72	3	858	24	902	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001218_00912.