CAZyme Information: MGYG000001219_00711

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-56
• CAZyme ID: MGYG000001219_00711
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
243	MGYG000001219_48|CGC1	28279.43	8.5693

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001219	2541038	MAG	Austria	Europe

• Gene Location: Start: 6518; End: 7249 Strand: -

Full Sequence      

MKKKRKKQHRIRKICLGLLLSCFCILVGAGVFFGIRGYGLYREATAEESLEERIEKVRSI
EHFTRYSEMPRFYRQAVISVEDHRFWEHYGIDPIAVTRAVWTNLKTMSFAEGGSTITQQL
AKNLLFTQDKRIERKVAEVFAAFEIEAEYTKEEIFELYVNAAYFGSGYYGIYQAARGYFG
KEPMELNDYESAMLAGIPNAPSAYSPDTSKEMAFRRVKQVLDSMVRHKIITREEAERIER
EKE

Enzyme Prediction     

No EC number prediction in MGYG000001219_00711.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	61	225	1.8e-61	0.9265536723163842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	3.12e-79	64	225	16	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	2.39e-68	63	231	4	172	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.40e-66	65	231	80	247	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	6.89e-65	10	231	3	237	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	2.98e-44	18	231	8	236	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYX26381.1	6.57e-97	19	238	11	230
QRP41835.1	2.51e-75	18	235	16	227
ASN93505.1	2.51e-75	18	235	16	227
QJU22158.1	1.01e-74	18	235	16	227
ANU46909.1	2.88e-74	18	235	16	227

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	4.79e-44	69	236	28	195	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	1.91e-43	69	236	28	195	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
4OON_A	5.43e-33	65	226	43	204	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5U2G_A	6.51e-32	67	234	46	213	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
5ZZK_A	4.02e-30	49	224	42	226	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9KNU5	2.66e-40	18	234	8	239	Penicillin-binding protein 1A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcA PE=3 SV=2
O66874	4.61e-39	69	236	71	238	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
O87579	4.41e-37	63	231	70	238	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
P38050	4.93e-37	67	211	73	221	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
O05131	2.83e-36	63	231	70	238	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae OX=485 GN=mrcA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998976	0.000109	0.000211	0.000001	0.000001	0.000734

TMHMM  Annotations     

start	end
13	35