CAZyme Information: MGYG000001222_00483

Basic Information

• Species: UMGS1326 sp900550775
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Monoglobaceae; UMGS1326; UMGS1326 sp900550775
• CAZyme ID: MGYG000001222_00483
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	MGYG000001222_9|CGC2	41466.72	6.4909

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001222	2203618	MAG	Austria	Europe

• Gene Location: Start: 20968; End: 22062 Strand: -

Full Sequence      

MQNQIIDLSKQLCDTMIRRFPNAKDLPPKHLFHYHQGVFLSGMLKTWSLCKDETYFHYAK
AWVDSLIHPDGTIDRYDSTRLDDIQPGILLFPLYRVTGDPRYKKALETLIGLLKNWKKNG
FGGFWHKDCHPDQMWLDSLYMAGPIQAEYAAFSGESGFLDEAARQALIMYAHMVKKENGL
MYHAWDASKKEDWADKESGLSPMVWGRAQGWYVVAILDILEFMSPDHPDYAPLLEIERTL
LTNIMKYRDEKTKMWYQVPDEGTRPGNWIETSCSCLFTAALAKAIRMGIMNKCHTAYVGE
CCKALCDSLKRKDGDVVVDNVCIGTGVCDYQGYIERPTCENDLHGVGAFLLMSTETARLI
GAAK

Enzyme Prediction     

No EC number prediction in MGYG000001222_00483.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	27	357	6e-98	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	5.62e-100	10	359	13	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	5.78e-98	9	359	2	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
cd04791	LanC_SerThrkinase	0.002	7	180	109	289	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ52128.1	3.86e-127	10	355	14	358
QNK55786.1	2.83e-126	6	355	11	359
BCJ92567.1	4.81e-126	1	360	1	359
AZK46659.1	8.07e-126	6	355	11	359
AFH61356.1	1.79e-125	6	364	11	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NC5_A	4.22e-95	9	363	17	371	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.75e-94	9	363	7	361	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	5.54e-72	9	355	5	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	2.31e-94	9	363	17	371	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	8.84e-23	141	359	1	231	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	8.84e-23	141	359	1	231	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
P9WF04	7.21e-06	128	355	194	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000085	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001222_00483.