CAZyme Information: MGYG000001222_01340

Basic Information

• Species: UMGS1326 sp900550775
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Monoglobaceae; UMGS1326; UMGS1326 sp900550775
• CAZyme ID: MGYG000001222_01340
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411		46292.63	5.4755

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001222	2203618	MAG	Austria	Europe

• Gene Location: Start: 18048; End: 19283 Strand: -

Full Sequence      

MDKIKVGWIGLGNRGMSLLKDVVLAQKEQVTAVCDIYDDRAEAGADAVEAAGQKRPAVFQ
DYKELIAAADVNTIVIATAWESHIPIAVAAMKKKIAVAMEVGGVYSLMQCYELVKTYEET
KTPFMFLENCCFGRRELMVKNMVEQGVFGEVVHCSGGYHHDLREEISGGIKNRHYRFRNY
LQRNCENYPTHELGPIAKVLNINHGNRMLTLTSTASKAAGLHTYIKKNESGDADLSHAKF
AQGDIVTTVIKCANGETITLTLDTTLPRFYSRGFTVRGTAAMYEEATDSVFMDTEEDRAH
DYDWRQECFGNAEKYTEKYDHPIWKQYIKEGVQGTHDGMDWLEFKLFFKALRKGEPMPVD
VYDAACWMAVSALSEQSVVRGGAVVDIPDFTEGKWLMHVVDEKSLREEEEK

Enzyme Prediction     

No EC number prediction in MGYG000001222_01340.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	1	395	8.2e-143	0.9849624060150376

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.63e-16	1	161	1	158	Predicted dehydrogenase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO31207.1	2.85e-173	1	396	1	396
QTH43530.1	9.18e-170	2	396	3	396
QIB57148.1	4.47e-167	1	397	1	391
QMW80076.1	4.47e-167	1	397	1	391
QBE96673.1	4.47e-167	1	397	1	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	1.91e-89	3	395	20	431	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	1.99e-62	1	395	40	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
3EC7_A	1.45e-06	4	159	24	177	CrystalStructure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_B Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_C Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_D Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_E Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_F Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_G Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_H Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2FLK4	4.45e-90	3	395	33	441	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A4Q8F7	1.05e-88	3	395	20	431	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
A4Q8G1	7.95e-85	4	396	53	460	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A6LB54	8.33e-84	3	396	49	458	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A3D6B7	1.92e-76	1	395	52	448	Glycosyl hydrolase family 109 protein OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) OX=325240 GN=Sbal_2793 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001222_01340.