CAZyme Information: MGYG000001222_01697

Basic Information

• Species: UMGS1326 sp900550775
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Monoglobaceae; UMGS1326; UMGS1326 sp900550775
• CAZyme ID: MGYG000001222_01697
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
845		94748.95	5.9855

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001222	2203618	MAG	Austria	Europe

• Gene Location: Start: 12317; End: 14854 Strand: +

Full Sequence      

MHLKPIQLRVNNMPSDRYAVVTDAPVFSWSVDAESNAAVTACHITVTDGDDLLWDSGERK
NETAAVYEGKPLLPGMRPTWQLCLTDENGNRGEETACFRVVPKTLRAPWITKTNQPKSRP
IYLAKQFTIQKDIARADLYVSGIGYQSVSINGRPADSAVLQPAVSNYKEQCYFVTLSAEH
LLQKGKNCIGVKLGDGWRQNEGAYLRNVKRKIAFFGTPQLILELHCKYTDGSTEIMQSDT
SWHAFNGGTVRAHLFDGETYDARKEPIGWDTPDFDLSGMPNAVLAETLGEIKPQTIEPIT
IQRRITPVSKTLIAPETYVFDFGENIAGYPEIKIPNGMAAGEKITMTFAEEIDEDGDLER
NSMRGAASLDEYIASGREQNAVWSPSFVYHGFRYMKLCGRYGIPSPDDIAAVVVSGDIAQ
TGCFTCGSALLNQIQDNILRSERGNLHSIATDCPQRDERMGWLNDATVRFEETPYNFDMS
RLFPKIIADIRAEQTADGTITCTAPYVYGNRPADPVCSSYLVLGWQCWLHYADKSLLQQY
YNDWKRWNDAIAALSEDGIVSYSCYGDWAGPVDSCQSYENARSSDTPDALMSTGYHYYNY
CMLAKMAEVLGDAEEKQRNEAAAAVIKEAFLKKWYDAKTGTVATGSQGAQSFALWLGILP
KKGRQKAADRLHDAVKAIGYRLKCGNLTARYVLEMLSDYGYVDDAFRIMTRETYPSFGYM
IQNGATTIWERFELKKNSGMNSHNHPMYGAVGAWFYSRIAGLTPIADGWKQFAVSPKIPT
DLLSAKAQLKTVRGDVCVQWFRRYGKLNIQVTVPYGAECFYEYENDKKILHHGFHHFSYE
EQEGK

Enzyme Prediction     

No EC number prediction in MGYG000001222_01697.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	314	818	1.9e-142	0.9801587301587301
CBM67	107	287	3.6e-28	0.9602272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.70e-97	419	759	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	7.90e-45	131	301	1	170	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.67e-25	313	415	3	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.53e-10	761	819	1	59	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA22854.1	2.41e-178	24	814	52	842
VEH16339.1	4.79e-171	106	833	148	864
AHF90970.1	1.10e-170	40	817	48	838
QEC51112.1	1.64e-163	25	814	90	886
AEE96386.1	6.93e-157	5	814	10	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	3.60e-150	25	818	51	893	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.47e-97	56	833	246	1007	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.42e-85	119	801	130	817	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	1.42e-118	25	814	55	869	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	1.70e-107	4	819	30	874	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	6.52e-97	56	833	246	1007	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	1.20e-95	12	819	38	902	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001222_01697.