CAZyme Information: MGYG000001224_00498

Basic Information

• Species: Blautia_A sp900547615
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp900547615
• CAZyme ID: MGYG000001224_00498
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
767		87310.42	4.1974

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001224	2725893	MAG	Austria	Europe

• Gene Location: Start: 63988; End: 66291 Strand: +

Full Sequence      

MRKKVYKKISLLMAACMTAGMMGSVNVQAESLYTQEDFANVLDVTARLDETAYGYYETDK
FNIFSDMGAWHGYHLHTLDDVDTYGGFAGPHIIGQDIGMNLSDCISRLKLKKADGEEIDL
TDARTYTAYYPGKLMQYYEERDEYKVTLELIFASGRTNYVRTTIENYSDEPLVLDVAWDG
KVFDHNNIGDDAYPTNATFEDCENGVQVGFTEYSDAWTTTEETKYTIRHSEEVTTEIAED
KMSYVSRLNEPVTVEKGTPYVTYTAESYTFTADEAAEESKVVEGLFAEPEKAFEENRTRW
QEYLDKTFDKEDDVPKPYKNATVKAMETLITNWKSPAGKYKHSGLTPSMSYMWFNGVWGW
DTWKNAAGIAEFDPQLAADGIRCMFDYQIQEDDPVRPQDAGTIFDCFTYKEGSENFRNSK
PPLAAWGVWKVYQEGGDKAFLEEMYPKLTAYHDWWYTNRDTDHNGVAEYGGMVHKAHYQK
DEDGNILKDENDKPLLNVENIIEAAAWESGMDNATRFDQEGNGPDDIGVFVYENKNAEGE
VVGYSLNQESVDLNAMLYAEKGFLKSIAEELGKTEDAAKYEAEAEKLAEYINTNMWDEET
GFYYDLQINEDGSEKKILTNRGKGTEGWMPLWAKLAPADRAEKVKDNMMDEGKFNLRVPM
PTASFDNDKFNPSRYWRGPVWLDQALYGVESLQNYGYEEEATELAYKLFDGAEGVLTDGP
IHENYNPVTGEGLHTKNFSWSAAAYYMLYEDALAETNPSTQTGLEMK

Enzyme Prediction     

No EC number prediction in MGYG000001224_00498.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	9	753	8.5e-178	0.9842105263157894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	0.0	8	751	2	782	alpha-glucosidase; Provisional
pfam01204	Trehalase	1.48e-21	419	748	178	504	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG3408	GDB1	8.00e-16	343	749	268	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
COG1626	TreA	4.48e-13	551	708	354	499	Neutral trehalase [Carbohydrate transport and metabolism].
pfam03200	Glyco_hydro_63	4.90e-13	551	742	252	486	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAK81591.1	4.70e-300	6	767	3	769
AQM60257.1	1.77e-295	9	764	11	777
QQP70135.1	8.92e-295	30	761	50	793
AIY84390.1	9.07e-294	9	764	11	777
AIF42982.1	2.72e-292	36	761	53	787

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	1.40e-144	53	751	21	755	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	7.74e-144	53	751	21	755	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	1.09e-143	53	751	21	755	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	1.75e-138	36	751	4	756	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	1.17e-58	484	751	9	304	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	1.46e-143	53	751	44	778	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	1.65e-14	358	743	98	479	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	2.19e-14	358	743	98	479	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
Q757L1	3.24e-10	354	747	290	701	Probable trehalase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=NTH2 PE=3 SV=1
A8AFT6	2.46e-09	354	713	158	490	Periplasmic trehalase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=treA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002189	0.991956	0.004599	0.000490	0.000377	0.000352

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001224_00498.