CAZyme Information: MGYG000001224_00522

Basic Information

• Species: Blautia_A sp900547615
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp900547615
• CAZyme ID: MGYG000001224_00522
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
813		90402.18	5.1358

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001224	2725893	MAG	Austria	Europe

• Gene Location: Start: 90409; End: 92850 Strand: +

Full Sequence      

MREECRYKDQNQNIEIRVEDLLSRMTLEEKAAQLCGNLPSSVITDGELDMEKLREVGKHG
HGRFTQYSLVGLVSPEKIASISNRIQRFFIEETRLGIPVALQSENLCGYPAAGGTIFPAM
CNLGCAWEPELLETMGEIIGEESKAVGINSAMSPVIDVSRDPRWGRTYETFGEDPYLISQ
MGLHYVRGMQKKGVSCIAKHFLGYGETQGGLNVAATRINDRELYETFATPFEAADKEAGL
DAIMASYSEIDGIPVGSNPVIARKLLRDTMGFQGMLTSDGAAIWKMFDYFHIANSYEEAG
FLAKKGGLDTEIPVGNAYKMLPEFVRNGMLSEEYLDESVRRILRIKFKRGLFEHPYVDEK
EVFSHMTDKKKKEYSKMLAKKSLVLLKNKDHLLPLDKEKKVAVIGPHGDSLRYPVSGYTY
PAYIEMLKASVDQKGSDEITFNGIVDEAKKEKKSSGFNTMYDMFSREDYNRLYDVDDILI
QLGASTLQEELGKYYSVIYEKGCEILGEDRSSFSKAVEAAENSDVVVAALGGNCGWVNVT
GGEGKDRCHLDLPGVQQELLQEIIKTEKPIILILYGPGIFSITGEEEHVDAVIQAGLPGP
YGSKALAEVLEGKYNPGGKLSVTVPRSVGQIPIYYNHKTGSGYNAGIGAEKSLIFSGGYV
DESNMPLYPFGYGLSYTQFEIRDVEIPETEISTNGTVEIDCTVENVGKVRGDEVVQLYYH
FRNAHVIRPVMQLVGFKRVTLESGEKKKIHFSLKTAQLGYYNEEMEFVVEPGKADIFLGT
SSVDLPFCKEIVLTGKKNPVMGKRIYTCPVTVK

Enzyme Prediction     

EC	3.2.1.37	3.2.1.55	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	91	311	2e-61	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.10e-152	18	784	38	756	beta-glucosidase BglX.
COG1472	BglX	8.06e-84	25	420	1	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	2.53e-75	26	345	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	3.04e-66	68	780	55	763	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.28e-47	383	676	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAT49116.1	0.0	7	813	4	817
SNU95883.1	0.0	7	807	6	803
QQA37498.1	9.57e-314	6	812	3	804
ADD01525.1	7.51e-214	7	796	6	769
AFM44649.1	3.62e-212	2	796	6	772

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	6.05e-122	3	785	3	748	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	4.60e-121	3	785	3	748	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5XXL_A	6.03e-120	18	785	14	744	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	3.26e-119	18	785	14	744	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	4.86e-114	18	782	13	740	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH9	1.42e-125	7	784	29	746	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
T2KMH0	1.08e-116	94	782	62	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	8.81e-116	18	782	38	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	3.59e-114	18	782	38	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
P14002	2.20e-80	18	785	5	660	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001224_00522.