CAZyme Information: MGYG000001224_01881

Basic Information

• Species: Blautia_A sp900547615
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp900547615
• CAZyme ID: MGYG000001224_01881
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476		55032.92	8.8158

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001224	2725893	MAG	Austria	Europe

• Gene Location: Start: 17815; End: 19245 Strand: +

Full Sequence      

MSEHLRTVVEIVNFFFLFFVVFYTVFLFLSVIYGAIESEKRSRQSMFHKGVSVDHAVNYV
PISILVPAYNEELTILDTVRSLCALDYPEFEVIVIDDGSRDNTAKVLIEALHLKKTERPI
RRQVYCQDAIEIFESEHSEISITLVRKKNGGKGDALNMGINLARYPYFLSLDADSVLQKD
TLKKLIMPVLSDSRVIAVGGMVQIANEMIIEKGEVKEFRFPHKFVVLMQMLEYSRTFMAM
RMFLDSFNSNLIISGTCGLFRKDMVIQTNGYKTDTVGEDMELVVKLHAYCRSKKIPYKIA
YASDAICWTQVPSRLRDMKTQRRRWQMGLMQSLYAHKMVLFNPLYGVMGVISTLYYLMVE
MLGPFIEFAGFLVICLAAALEMLNVPFMIWYFLLFYLLSTLVTITAFFTRIYVLKAPLTV
WQAVKVAVLAFVESFCFHHLITLFRLTAFVNYKKTKLQWGKIQRQVHNRSDGYIEE

Enzyme Prediction     

No EC number prediction in MGYG000001224_01881.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	63	231	1.5e-26	0.7764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	7.08e-63	64	279	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	3.17e-54	61	476	55	436	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	5.89e-43	59	407	53	397	N-glycosyltransferase; Provisional
pfam00535	Glycos_transf_2	1.09e-27	63	265	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06421	CESA_CelA_like	8.14e-27	64	333	5	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI73330.1	4.95e-140	5	469	2	466
QEZ70189.1	5.12e-138	5	469	2	467
QNK56534.1	2.82e-137	1	468	1	465
QUO31269.1	3.86e-137	1	469	1	466
CEK37714.1	1.25e-136	5	471	2	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TZE_C	6.17e-07	63	183	4	102	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	8.61e-07	63	183	4	102	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]
3BCV_A	1.30e-06	62	180	7	100	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HKQ0	5.72e-24	15	328	6	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1
Q8GLC5	7.75e-24	62	328	49	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q6GDD8	2.94e-22	19	328	6	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q7A351	2.94e-22	19	328	6	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1
Q5HCN1	2.94e-22	19	328	6	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000020	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
15	37
333	355
365	387
392	414
427	449