CAZyme Information: MGYG000001224_01907

Basic Information

• Species: Blautia_A sp900547615
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp900547615
• CAZyme ID: MGYG000001224_01907
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
562	MGYG000001224_40|CGC2	65382.34	6.5133

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001224	2725893	MAG	Austria	Europe

• Gene Location: Start: 18668; End: 20356 Strand: +

Full Sequence      

MDIIYVSYNSEKWIERCFGSVLKSEYDLKKVNIYVVDNHSSDHTLEKLKKIKPEMEEQVG
SFQVIESQENLGFGRGNNLGFSKGNSELVCFFNIDTELLPDTLKELEQAVKASDEKTAMW
ELRQFPYEHPKNYDPLTGETTWSSGAAFAMKREIYEKLGGFDEKIFMYAEDVDLSWRLRS
FGYKIRYVPKSVIMHYSYEEAGEVKPNQHVYGVINNMMLRYRFGGLKDILKGHLKFWFLM
VTPEAFPGSKKMLRREYWRHFGKIPHFYSRKSRGKDASFHAEFLNWDYSVNREGGFYVNE
FPKETPKVSVIVRTCGRPSVLRETLVSLRSQTYPNIEIVVVEDGENVSETMLREEFGDLN
IVYMATGEKAGRSKAGNLAMSAATGKYLNFLDDDDLFYADHVEVLVTNLLKTENRAAYSF
AFETPVEVRSKEPYVYEVKGWNATHTQEFDKVKLCHHNYIPIQAIMFEKSLFEESGGLDE
TLDALEDWDLWVRYSLHTDFTCVKKTTSLYRVPHDRKINSERQKALDEALAVVRNKHKTY
IQTVSVYDIAMMYEKRSILPPR

Enzyme Prediction     

No EC number prediction in MGYG000001224_01907.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	309	457	1.9e-21	0.8823529411764706
GT2	2	168	4.1e-20	0.9411764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	1.94e-50	3	196	1	165	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.92e-38	3	265	7	287	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd00761	Glyco_tranf_GTA_type	1.81e-23	3	188	1	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd02525	Succinoglycan_BP_ExoA	1.42e-19	3	196	4	208	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
pfam00535	Glycos_transf_2	1.24e-18	309	418	1	112	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAV25728.1	8.10e-199	1	549	8	555
QGG58197.1	7.49e-186	1	554	4	556
QTA80415.1	3.12e-144	1	554	12	565
QJR09954.1	7.19e-142	1	552	4	563
APV52136.1	3.63e-139	1	552	4	562

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	1.28e-10	308	549	7	252	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZDI9	2.82e-15	305	494	7	193	Uncharacterized glycosyltransferase RP339 OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=RP339 PE=3 SV=1
Q68X33	6.85e-15	305	494	7	193	Uncharacterized glycosyltransferase RT0329 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=RT0329 PE=3 SV=1
Q1RIM7	2.14e-12	306	493	13	199	Uncharacterized glycosyltransferase RBE_0706 OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=RBE_0706 PE=3 SV=1
A0A0H2URH7	6.06e-11	307	497	6	213	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1
Q4UM29	7.23e-11	307	512	294	491	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001224_01907.