CAZyme Information: MGYG000001230_00234

Basic Information

• Species: Eubacterium_R sp900542875
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp900542875
• CAZyme ID: MGYG000001230_00234
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
805		92595.87	7.7355

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001230	1727677	MAG	Austria	Europe

• Gene Location: Start: 247948; End: 250365 Strand: +

Full Sequence      

MGTTIRKTLNRISNPYWRAKYKYIKYVDKMPIDDKMILLESQHGKEFNGNIFSMAKYLCS
AEEYKEYKVYLSAAKSRVNSFKKKAEEYGIKNLNFVILSTKEYFKVLASAKYLVNDNTFL
PFFIKREGQIYLNTWHGTPLKCLGRKIKNDAVNIGNPQRNFVSADWLLYPNDYTKEHIIE
DYMLANMSNSKIVMGGYPRNDIFFNGKRRDELRQSLGLENKKVYAYMPTFRGTAREGTSE
QSEDYMLKSLYALDKELNDNEVLYLNLHPVSQSTVNFGDFKNIKPFPSNLDTYDFLNIAD
CLVSDYSSVFFDFACTKKKIILFTFDKEEYLRDRGLYISLDELPYPQVSDYKALLDEMRA
EKNYDDEEFLQKFCPYDNINSSKQLCDQIILGKDCGLKTESMPNNGKENVLIFAGNLAPN
GVTASLRNLLTLLDKSERNYYINFRQTAADQYSDNMLSLTQNGVSYYATKNEFNLTVGNL
ACKLLFRLKLMNVKTYMFFCHKRVKQNFDKEFGATNFSTYIQFSGYAADPILKFMQTDKN
SIIYVHSDMLKEIKQRGNQRADVLRYAYSHYNKVAVVTEDIIPPTEKLGGGDRICVAKNA
IPYKTIAEKAELTPRLDETTQCSLSHEDAMKFLLDKSTKKFITVGRFSPEKGHDRLVNAF
ENFAKNHEDARLVILGGSSYEDHYEKLLKLITDKHLTDKVLLIMDVSNPYAIIKLCDSFV
LSSYYEGFGLVLAEADIVGLPVISTNITGPRGFMNKYGGTMVDNSQGGIEEGLKLLYDGK
VPMLKTDYEQYNKEVVEEFEAMLKN

Enzyme Prediction     

No EC number prediction in MGYG000001230_00234.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	633	776	4.7e-31	0.90625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	7.10e-68	31	391	1	360	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	7.61e-43	20	390	12	385	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].
cd03811	GT4_GT28_WabH-like	9.29e-43	409	794	1	338	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
pfam00534	Glycos_transf_1	5.99e-26	639	751	3	114	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03820	GT4_AmsD-like	7.15e-23	633	751	176	292	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL33357.1	4.42e-280	3	802	6	806
CBK97012.1	6.26e-280	3	802	6	806
QQQ92281.1	7.25e-198	23	802	20	795
ANU74732.2	1.12e-197	23	802	34	809
ASU27537.1	1.12e-197	23	802	34	809

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	1.13e-32	6	389	320	714	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	8.24e-32	6	389	320	714	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	1.92e-31	6	389	320	714	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RKI5	1.97e-35	25	390	22	393	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q5HLM5	5.99e-32	6	389	320	714	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
P13485	6.64e-32	7	389	353	742	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q2G1C1	5.18e-31	10	389	4	387	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
P27621	2.01e-18	106	389	94	376	Teichoic acid glycerol-phosphate primase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001230_00234.