CAZyme Information: MGYG000001230_00437

Basic Information

• Species: Eubacterium_R sp900542875
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp900542875
• CAZyme ID: MGYG000001230_00437
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642		73643.39	5.4288

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001230	1727677	MAG	Austria	Europe

• Gene Location: Start: 441534; End: 443462 Strand: -

Full Sequence      

MFRLESKRLKREFKNNDGNFYASQIVNSYSNMNFIPDGNGSEFVIKFADGSEVTSKGLPV
ENAGYEGDKLVFDFTEDMGVKVTLKYWVHKDGNTVCKQIIINQSTNAVIDYVDLECVGII
NSKTHFCVDVVEGGEIPAFWSMLGQPVYVDSLFFGCEFPATENRIIHGNATVRYYIGSSV
GSNFVCPVTVMGAGPDNTLAGVRNAFYEYIDFISVPAPLRFQYNSWYDYMKDITEDNIMV
SFAEVHKQLTAYGAPKLDAYVVDDGWPDTKAGFWSFNKKFPNKLTKVTALCNSMDSHFGL
WLGPRGGYTRPDKIAKRMQRAGNGYLNKQAKDICVASSKYVEKLGDFLVDTTNEFDIDYW
KLDGFCLAPCENSKHDHAVGGYENMYFVTDMWQKWIRLYERLRAANPKLWINITCYVNVS
PWWLQWVNSLWVQNSGDIGFAKNIENQAQVDKEITYRDARYYDCLCKRALQIPLKNLYNH
EPIYGNTAHVNYTDEEFEKYIYWCTVRGQALNELHLSVNMMNESKWTSLSEAMNWQKDNF
HILKNAQFIGGNPEENNIYGYISWTPEGEGIIAMRNPNNEETSLTLTFNKLMGTPQSLKG
AKCFNVYCKSMSETDETYDYNSKMDLTMKPFEVMIFKIAKER

Enzyme Prediction     

No EC number prediction in MGYG000001230_00437.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	2.88e-13	223	411	6	194	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG3345	GalA	1.04e-05	184	304	253	377	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd06592	GH31_NET37	0.007	222	402	4	184	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT26415.1	2.57e-144	4	639	38	725
QDO70357.1	3.39e-143	9	639	43	725
AGZ23147.1	7.18e-127	3	635	2	617
QTJ52371.1	9.90e-127	1	587	1	590
QTJ59118.1	1.40e-126	1	587	1	590

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001230_00437.