CAZyme Information: MGYG000001230_00688

Basic Information

• Species: Eubacterium_R sp900542875
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp900542875
• CAZyme ID: MGYG000001230_00688
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
507		58674.22	4.8563

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001230	1727677	MAG	Austria	Europe

• Gene Location: Start: 225163; End: 226686 Strand: +

Full Sequence      

MLDKRGAGVLMHISSIPSSYAVGVFGDETKHFIDKIADMGFTYWQVLPFNPIDSANSPYC
SESAFAGDYIYIDPEKLYSMGLISKEDLESNIYSGTPYTADYEFAKKQRLETLKTAFLNI
DDELAKKIKEFELENSWLTDYAVFMAVKEEESFKPWWQWSEKHAKYFECIKDIYSFENRA
AFWKFVQYIFYSQWYEIKKYANKKGIAVIGDMPIYVAMDSVDVWAETSMFLIDETTLKAK
KVAGVPPDYFSKDGQLWGNPIYDWDKMKKSGYSWWLSRLAHNLKVYDTVRIDHFRAFASY
WAVPAESETAKVGEWIDGPRMDFFNAVFEKFGNDVPIIAEDLGTFGEDVIKLLSNTGFPG
MKVVQFGFDPNSDSSHMPHNAEKNSINYVGTHDNNTILGWLWEASEEERKFALDYCRFYG
DNWGEGGYKSRSCRAVIETVWQSASNIAIIAFQDMCGFGSDARMNIPGVPEKNWRFRTTR
ETVDSIDSDYFKHINSLYRRMYPVFEK

Enzyme Prediction     

EC	2.4.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	11	496	8e-148	0.9838056680161943

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14508	PRK14508	0.0	1	500	1	496	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	0.0	11	477	1	456	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PLN02635	PLN02635	2.67e-146	3	477	26	499	disproportionating enzyme
COG1640	MalQ	7.60e-137	4	500	13	514	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
TIGR00217	malQ	2.26e-116	1	500	10	513	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARD65542.1	3.47e-174	1	501	1	506
ADO38582.1	4.56e-172	1	501	1	506
QCT73240.1	2.11e-170	1	501	1	506
AWW25287.1	1.18e-156	2	500	3	506
ALU15685.1	2.23e-155	39	501	1	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TZ7_A	7.69e-126	5	500	22	503	Aquifexaeolicus amylomaltase [Aquifex aeolicus],1TZ7_B Aquifex aeolicus amylomaltase [Aquifex aeolicus]
6M6T_A	1.32e-121	1	500	1	496	ChainA, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_B Chain B, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_C Chain C, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_D Chain D, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_E Chain E, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_F Chain F, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_G Chain G, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_H Chain H, 4-alpha-glucanotransferase [Streptococcus agalactiae]
5CPQ_A	3.93e-111	3	501	68	564	Disproportionatingenzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPQ_B Disproportionating enzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPS_A Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPS_B Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPT_A Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CPT_B Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CQ1_A Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CQ1_B Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CSU_A Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSU_B Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSY_A Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana],5CSY_B Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana]
1FP8_A	7.49e-110	5	477	5	476	StructureOf The Amylomaltase From Thermus Thermophilus Hb8 In Space Group P21212 [Thermus thermophilus],1FP9_A Structure Of Amylomaltase From Thermus Thermophilus Hb8 In Space Group C2 [Thermus thermophilus]
1CWY_A	1.49e-109	5	477	5	476	CrystalStructure Of Amylomaltase From Thermus Aquaticus, A Glycosyltransferase Catalysing The Production Of Large Cyclic Glucans [Thermus aquaticus],1ESW_A X-Ray Structure Of Acarbose Bound To Amylomaltase From Thermus Aquaticus. Implications For The Synthesis Of Large Cyclic Glucans [Thermus aquaticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59266	8.88e-134	11	477	1	462	4-alpha-glucanotransferase OS=Clostridium butyricum OX=1492 GN=malQ PE=1 SV=1
P0A3Q0	1.05e-125	2	501	1	496	4-alpha-glucanotransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malQ PE=3 SV=1
P0A3Q1	1.05e-125	2	501	1	496	4-alpha-glucanotransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=malQ PE=3 SV=1
O66937	3.18e-125	5	500	2	483	4-alpha-glucanotransferase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=malQ PE=1 SV=1
P72785	4.75e-124	1	502	1	502	4-alpha-glucanotransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=malQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999971	0.000037	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001230_00688.