CAZyme Information: MGYG000001231_01138

Basic Information

• Species: CACZQA01 sp900758075
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; QAMH01; CACZQA01; CACZQA01 sp900758075
• CAZyme ID: MGYG000001231_01138
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
600		67183.61	4.7283

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001231	1876498	MAG	Austria	Europe

• Gene Location: Start: 1383; End: 3185 Strand: -

Full Sequence      

MIVGKVARGVARRLRPERPVPLKDRFPIDAWTDPNYQEWFDRHKASAETLAAQRVRRFDS
APTFSIVVPLFETPLDYLHAVVGSVQAQTYQGYELVLVNASPENDELRREVEKLTRDDEK
IVHVVLDGNYGITENTNRGIEAASGDFLSFLDHDDFLEPDTLFEFASALESDPLIDVLYC
DEDLVTVDDKGCHNMHPFFKPDYSPEYLLCKNYAIHLMTIRRTIVKDITDRTAVYDGAQD
YNMILNAVERARAVHHVPRVLYHWRMSEKSTAANTSAKPYGRVASRLGAKRHLERMGEHP
AIFPTKIVNLHSLWFAPDAEDLVTVIIAGDDDVQKTAITLTYLAQTNSYPNLEVIVVAPQ
ELAGVDLIDDEEHTFIACAQTASAAEKLNVGAAAAHGVYLLFLQAGNYFMSPEPVEQLLG
MCGRVGVGLVGPKLLYWDGEVRSFGVACTGERIMPLYRGYPNDFPAYQCTLESFQNVSAV
EFDGMMVARELFEEAGGFDPGFAGPIGCADFCTSVRQRGRRIVTSPNVRLHTADRCPGER
YNATKNCPEFSEADTQRYDEKWPDARKGGDRFVNPNLDQASEYFQVQGSPLVNVESETSE

Enzyme Prediction     

No EC number prediction in MGYG000001231_01138.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	65	178	3.2e-20	0.6588235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	2.37e-70	62	266	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd06433	GT_2_WfgS_like	1.18e-17	84	271	19	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	4.29e-17	65	179	1	113	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	2.25e-16	76	180	10	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd04186	GT_2_like_c	2.54e-14	66	173	1	103	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH69456.1	3.16e-113	33	577	262	811
QOY61387.1	2.44e-112	33	586	248	809
ATP53720.1	1.00e-110	33	586	262	823
ACV56006.1	2.42e-110	28	584	270	827
ACV56016.1	2.41e-107	28	583	228	788

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	3.56e-08	59	215	2	147	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.00e-54	39	577	344	888	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	5.66e-43	6	577	274	831	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	4.36e-08	62	248	8	195	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
Q68X33	5.31e-07	61	208	7	147	Uncharacterized glycosyltransferase RT0329 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=RT0329 PE=3 SV=1
Q0P9C6	8.96e-07	62	157	2	96	GalNAc(5)-diNAcBac-PP-undecaprenol beta-1,3-glucosyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999318	0.000673	0.000034	0.000004	0.000002	0.000007

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001231_01138.