CAZyme Information: MGYG000001231_01173

Basic Information

• Species: CACZQA01 sp900758075
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; QAMH01; CACZQA01; CACZQA01 sp900758075
• CAZyme ID: MGYG000001231_01173
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
493		54998.41	7.6665

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001231	1876498	MAG	Austria	Europe

• Gene Location: Start: 305; End: 1786 Strand: +

Full Sequence      

MTTFVSTFNLFLFFVFSLCYMYQLVYALVVLVKDHRRKVPEPTAGKLNRYAVLISGRNEE
KVIGELVKSIKNQDYPSELIDVFVIADNCTDNTAEVAREAGAEVFVRNDKLVVGKSHALD
FALNKIRILYGDEDGRTNYDGYFVFDADNVLDPGFVAAMNRGFNRGYQVLTSYRNSKNYD
SNWVSAGSALWFLREAKFLSNARFILGTSCAISGTGFLIDADILESNGGWIHHLMTEDIE
FSTDCITNGIRIGYCGDAYIYDEQPTTFKDSWSQRMRWAKGFYQVLLKYGKNLFKGIFHG
NHGKFARYDMFMTIAPAMLLTITGFFVNFIFCLTGIIQLASIAASVETVAAGTTAGLAGV
TPADTNFFTNSIALLTGSLFQGDVLSTFNTSQVAVMLSYAEARATIITSVVSLASCFISF
GVVMLFFGILTTVTEWKHIHAKTSDKIKYIFTFPIFMMTYIPIALIAVFKKVKWTPIKHD
VVRSVSDVISKGN

Enzyme Prediction     

No EC number prediction in MGYG000001231_01173.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	49	279	1.3e-28	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	8.77e-81	52	241	1	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
COG1215	BcsA	1.45e-38	1	344	6	340	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	1.48e-34	52	238	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam13641	Glyco_tranf_2_3	2.80e-24	48	281	2	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06439	CESA_like_1	1.84e-21	22	285	5	251	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI61275.1	1.31e-154	1	488	1	422
QTU83730.1	1.33e-143	3	488	10	428
ACV55180.1	2.95e-143	3	488	10	428
BAK44311.1	3.15e-142	3	481	10	421
QOS69441.1	1.36e-141	3	488	10	428

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	5.34e-06	51	151	16	113	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	2.95e-21	46	295	47	293	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
P74165	2.12e-15	52	289	112	343	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q8GLC5	2.72e-11	53	288	52	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q99QX3	4.82e-11	38	288	37	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=icaA PE=3 SV=1
Q7A351	4.82e-11	38	288	37	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	32
317	339
367	389
410	432
447	469