CAZyme Information: MGYG000001234_00666

Basic Information

• Species: Peptostreptococcus sp900759325
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Peptostreptococcus; Peptostreptococcus sp900759325
• CAZyme ID: MGYG000001234_00666
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
180	MGYG000001234_8|CGC1	20794	9.8664

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001234	1728437	MAG	Austria	Europe

• Gene Location: Start: 49842; End: 50384 Strand: +

Full Sequence      

MVNRGLLALILVFIVLILALINRENIEKIFYPTKYSQYVEKYSSEYGVDKYLVYSIIKTE
SKFHRRAISSKNAKGLMQITDITADWGREELGLGSIDIYDPETNINIGVWYLGKLQKEFK
GNYKLIIAAYNGGSGNVKKWLKSTDYSKDGRNLANIPFAETSKYTEKVLDNYKRYKALYR

Enzyme Prediction     

No EC number prediction in MGYG000001234_00666.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	36	175	2.2e-30	0.8962962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	5.22e-69	32	174	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.43e-51	31	178	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	9.25e-38	52	173	3	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	2.24e-36	31	179	135	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16893	LT_MltC_MltE	8.54e-32	38	173	2	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXU49364.1	1.35e-68	12	179	11	178
AWH80563.1	1.35e-68	12	179	11	178
AWH76797.1	1.35e-68	12	179	11	178
AXU45666.1	1.35e-68	12	179	11	178
AXU63798.1	1.35e-68	12	179	11	178

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.77e-18	31	179	412	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.77e-18	31	179	416	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.78e-18	31	179	426	573	Lytictransglycosylase in action [Neisseria meningitidis]
6FPN_B	1.78e-18	31	179	422	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O29_A	1.79e-18	31	179	432	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.71e-16	39	172	64	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P44888	1.15e-14	32	169	425	566	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
C5BCE9	2.78e-14	34	178	190	358	Membrane-bound lytic murein transglycosylase C OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=mltC PE=3 SV=1
A8GJ50	7.09e-14	34	143	190	311	Membrane-bound lytic murein transglycosylase C OS=Serratia proteamaculans (strain 568) OX=399741 GN=mltC PE=3 SV=1
P0AGC4	1.00e-13	31	175	476	627	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.613845	0.380122	0.004247	0.000486	0.000372	0.000927

TMHMM  Annotations     

start	end
5	22