CAZyme Information: MGYG000001234_01475

Basic Information

• Species: Peptostreptococcus sp900759325
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Peptostreptococcus; Peptostreptococcus sp900759325
• CAZyme ID: MGYG000001234_01475
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
245		28413.44	10.4574

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001234	1728437	MAG	Austria	Europe

• Gene Location: Start: 9073; End: 9810 Strand: +

Full Sequence      

MVFIASLDSRVRKKKLQNTGKSGKSTSNKYRQKNVSRGSKKKSKRPRRFLQVFILLILII
FAYTFANLFSYFDNIEIQTMTENNRSNQEFIDSLREISIVEYRKTGLLPSVTIAQAILES
NWGRSKLTKEANNLYGIKADASWHGDKVLFNTKEYYNSHVNAYFRKYKSWADSVTDRSNF
LMKNKRYLKSGLFETNTYRGQAQALEDAGYATTTNAKGEKIYADKLISVIKNYNLYEIDY
SVKPK

Enzyme Prediction     

No EC number prediction in MGYG000001234_01475.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	101	235	4e-35	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.47e-46	83	239	39	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK05684	flgJ	8.88e-29	86	231	151	295	flagellar assembly peptidoglycan hydrolase FlgJ.
NF038016	sporang_Gsm	1.56e-27	87	239	160	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
smart00047	LYZ2	1.83e-23	84	235	5	141	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	2.24e-23	99	235	5	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYE98805.1	1.19e-52	83	243	134	294
AUN13576.1	1.68e-52	83	243	134	294
CEJ72889.1	1.33e-51	89	243	140	294
AXB63823.1	7.86e-51	69	245	152	324
QGS39496.1	7.86e-51	69	245	152	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	4.98e-19	88	239	31	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	4.47e-16	88	231	4	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	6.17e-16	88	231	4	146	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5T1Q_A	1.58e-14	83	239	56	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	2.98e-26	39	239	2	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	3.03e-17	86	229	159	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	7.46e-17	86	237	160	313	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
P0C2T5	1.82e-14	86	239	61	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
A2RHZ5	2.46e-14	86	239	61	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999896	0.000114	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
49	71