CAZyme Information: MGYG000001237_00771

Basic Information

• Species: UMGS1600 sp900553295
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UMGS1600; UMGS1600 sp900553295
• CAZyme ID: MGYG000001237_00771
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
849	MGYG000001237_25|CGC1	94013.29	5.5213

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001237	2708995	MAG	Austria	Europe

• Gene Location: Start: 2946; End: 5495 Strand: +

Full Sequence      

MIRIVSLRLDGRRTDGYRSGCLADRTNPVLSWAAVSDQTEDRQSAYRVTAGSWDSGWITG
EGQQAQLPPGTLLPETPTAVTLCLRNRAGETSQPYTVMLLNAAVADWDAPWIGLDDAQPE
RVIYLRRQLNLTQPVRHARLDLCGLGYHAAWINGTRLDDARLDPAFMDYSKHIPFVSYLE
AAPLFHPGENEVIVAVGSGWRRNGRLHENQWFHGVSFPFEGPQQATARLRLTLADGTTWR
LTTDENWEAGYGPMGYANLFNGAVYDAREPLGPWRPARRMTPPGGQMQPMLLPPVLAREE
YAPLAWWQEGADAVVLDFGQNLAGVVRLPLPPDLAPGQVITLSHTEELTEDGRLFPDTLR
IAKAQDTYIAAGDARDLPLWEPEMTYHGFRYVRVSGLNPAAMDWSQVRAVALRTAVDKAS
FFRCGNALVTRLHEMCVATERSNLHSILTDCPQRDERMGWLNDATVRFESTPYQFEVGAL
FPKVIQDIMDAQHADGAIGDTAPFMAGCYPADPVCSSFLLAGRETYLHAGDLTAVRKAYP
AFAAWERCLLKHSEGQLPDYSYWGDWAGPADSCVPPKDDSDAAAASAVTPGKFLSAGFSY
LNCRLLAEMAGWLEMPQEAAQWEAQGEAVRQALLAKWYCPQTGSFATGSQGCLALALRFG
LAPDPALTALRLHEAVERAGYRLTTGNLCSRYIFDALTAHGYVEDAWRLITRDAYPSLGW
MLQQEATTVWERFELMKNPAMNSHNHPMYGAVDGWFYAYLAGLTPTAGGWRRFRVKPYLP
AALDSVQAGVETPMGRVDVRWTRRYGKRTLQVNVPFGAEAEVDFCGQTAHWGSGFHSMSL
PEAAAGKDL

Enzyme Prediction     

No EC number prediction in MGYG000001237_00771.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	311	823	5e-130	0.9861111111111112
CBM67	109	275	9.7e-17	0.8636363636363636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.02e-85	417	760	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.28e-32	134	295	2	168	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.70e-25	312	397	6	87	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	8.97e-15	762	822	1	61	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA22854.1	3.69e-148	7	822	32	849
AHF90970.1	1.81e-146	24	827	23	848
AEF82974.1	3.56e-146	28	822	31	839
VEH16339.1	6.51e-145	17	822	41	851
QEC51112.1	2.61e-141	28	822	90	893

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	9.93e-113	24	822	47	896	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	3.93e-84	105	822	285	992	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.06e-67	17	801	12	816	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	1.82e-83	105	822	285	992	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	2.54e-73	124	822	186	904	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	2.88e-72	27	821	50	875	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	3.82e-71	14	823	41	877	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998682	0.001306	0.000040	0.000003	0.000002	0.000004

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001237_00771.