CAZyme Information: MGYG000001237_01297

Basic Information

• Species: UMGS1600 sp900553295
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UMGS1600; UMGS1600 sp900553295
• CAZyme ID: MGYG000001237_01297
• CAZy Family: GT84
• CAZyme Description: Cyclic beta-(1,2)-glucan synthase NdvB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1610		179843.84	6.2098

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001237	2708995	MAG	Austria	Europe

• Gene Location: Start: 7089; End: 11921 Strand: -

Full Sequence      

MAMVEMGLLEADQAATRIRATVETLEALPKWRGHLYNWYDLNTLEVLDPPYVSSVDSGNY
VAFLMAAAQLLRQHLSELDAADRELPARMDALAEAVDLAALYDAQAQLFFVGFDTRQEQP
QGSHYDLLASEARLLSFVAICTRQVPLRHFSRLSRTRVALGREHLLMSWSGTLFEYLMPQ
LLLPLTPGTLLHHTCAAAVRCHIKAGKDGLWGMSESGYYAFDPQLNYQYRAFGLEALAAD
PDAQGKVFAPYAVALALSLYPDQAMAALQRMHSLGMDTPQGFLESIDLDTQRTGVPEGRI
VRSHMAHHQGMLLCAVANALTGDALSRAFCRMPKVRAFLLLLREREDRHRPITLTLPKPR
REAAPAPQIPQVPLAPLRLPVEAALMGGGKAFLLQSAGGLGVMGYDNIFINRFTRDPSCR
EGIQFYLLESGRLWEPFDPRLSGKVWAEDGCLVYTREHRELRMCLTCFVDPVDQCQIHML
ELENLSARERTLEVADYFELALAPEMEQLAHPTYHDLFIETAPFGDSGILAHRRRRDPQE
PCIYLCHLLAMPSDMEVFAQTDREAFLGRNGSPWQPWSLREKGKQGLFGAPIHPCASLRC
TVRLGGRGRIRLVYATYCRFQEQPPHPEDFSMDLTQLMQRQRMAQLRQQVLLNSLGIPVE
QLPLLTQLTGAVQWLHQPHQGVGTPISLPLEELWAMGLSGDRPLLAVFLNREESPLLPLA
LHFTALQRSLGMQVELAIAVLEEGGSLLDTAQQALDASPLRDLRGKGVAIMDKSTLTPQR
YALLHAAASLSLDDRLGTIREQLDSLRVPVTPTALAPRPPKQAPELPPEELHFFNGYGGF
LADEGAYVIRLTTDRNTPAPWCNYLCRPGFGTLCCESGLLFTYGDNSHRRRLTPWVNDPV
TPQGGEFLVVEDLDTGEMFSPTRLPFGQAMTCRVVHSPGVTVYRAFGEGLELQWTCFTDP
QQEAGCRQLRIRVHGNTARHLCLHACLRFVMGTDRRAEPFTCLTPLPGMVLAVNPGWPCL
GFLTDLEQEAEAHRMSPAAFQGLWGQRPWGLTPPKNHRPDSAEPCVIGAADRGNLAVLTR
TFALEKEGGATFTYLTGLARDPEEIEGLLERYRREGVSAMQRQVQRFWSGELSAFTCHVP
WESLSLMLNLCLPYQVRVARLWARAGLYQAGGAIGFRDQLQDMTALIYTNPEEVRRHLLL
CASRQYEAGDVQHWWHPGHAGVRTRITDDRLFLPFMTAWYIRRTGDVEVLAASAPFLVGA
DIPPGKHDLYHFAAPTAYAAPLMEHCLRAIRSLRFGPRHIPLMEGGDWNDGMNRVEGESV
FLGFFLCRVLDDFAPYCEASDAQELRQIRASVLEALEAHAWDGAWYVRAWYPDGRVLGSH
ESPACQIDLLSQCWAVLGGALPQRSSQALEGVLERLHRPELGLTALLTPPFSEDVDAGYI
SGYLPGVRENGGQYTHALPWFIWALAEMGQTDLAWALVGEALPIHHSDTQAKAECYRLEP
YFTAGDIYTAQGQQGRGGWSAYTGSAAWLYTVILEQLLGFKKQGTKVSLRPRLPEAWDGF
ALTLRIGQTTWHLQSRRDVPFTTLDGEKSPEGQVELVEDGKIHEASFPLR

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	560	1605	2.3e-225	0.9951737451737451
GT84	123	333	5e-62	0.9953488372093023

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3459	COG3459	2.01e-173	559	1603	2	1047	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	7.20e-96	1127	1541	1	425	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
cd11756	GH94N_ChvB_NdvB_1_like	8.19e-50	830	1113	1	284	First GH94N domain of cyclic beta 1-2 glucan synthetase and similar domains. The glycoside hydrolase family 94 (previously known as glycosyltransferase family 36) includes cyclic beta 1-2 glucan synthetase (EC:2.4.1.20) or ChvB (encoded by the chromosomal chvB virulence gene). This first of two tandemly repeated GH94-N-terminal-like domains has not been characterized functionally. Some beta 1-2 glucan synthetases are annotated as NdvB (nodule development B) gene products, glycosyltransferases required for the synthesis of cyclic beta-(1,2)-glucans, which play a role in interactions between bacteria and plants.
cd11753	GH94N_ChvB_NdvB_2_like	1.52e-37	329	616	5	308	Second GH94N domain of cyclic beta 1-2 glucan synthetase and similar domains. The glycoside hydrolase family 94 (previously known as glycosyltransferase family 36) includes cyclic beta 1-2 glucan synthetase (EC:2.4.1.20) or ChvB (encoded by the chromosomal chvB virulence gene). This second of two tandemly repeated GH94-N-terminal-like domains has not been characterized functionally. Some beta 1-2 glucan synthetases are annotated as NdvB (nodule development B) gene products, glycosyltransferases required for the synthesis of cyclic beta-(1,2)-glucans, which play a role in interactions between bacteria and plants.
pfam06165	Glyco_transf_36	4.50e-33	385	616	7	246	Glycosyltransferase family 36. The glycosyltransferase family 36 includes cellobiose phosphorylase (EC:2.4.1.20), cellodextrin phosphorylase (EC:2.4.1.49), chitobiose phosphorylase (EC:2.4.1.-). Many members of this family contain two copies of this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVX19642.1	4.13e-275	5	1603	1030	2760
AVX30049.1	2.97e-274	5	1603	1030	2760
ATW26012.1	5.95e-259	5	1609	1048	2712
ABC82952.1	3.39e-254	5	1604	1059	2735
ACL66712.1	3.90e-254	5	1604	1059	2735

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QDE_A	4.40e-51	839	1603	4	804	ChainA, Cellobiose phosphorylase [Acetivibrio thermocellus],3QDE_B Chain B, Cellobiose phosphorylase [Acetivibrio thermocellus]
1V7V_A	2.34e-47	837	1574	3	760	Crystalstructure of Vibrio proteolyticus chitobiose phosphorylase [Vibrio proteolyticus],1V7W_A Crystal structure of Vibrio proteolyticus chitobiose phosphorylase in complex with GlcNAc [Vibrio proteolyticus],1V7X_A Crystal structure of Vibrio proteolyticus chitobiose phosphorylase in complex with GlcNAc and sulfate [Vibrio proteolyticus]
3S4C_A	5.62e-43	837	1563	3	771	Lactosephosphorylase in complex with sulfate [Cellulomonas uda],3S4D_A Lactose phosphorylase in a ternary complex with cellobiose and sulfate [Cellulomonas uda]
3RRS_A	5.41e-42	837	1563	3	771	Crystalstructure analysis of cellobiose phosphorylase from Cellulomonas uda [Cellulomonas uda],3RRS_B Crystal structure analysis of cellobiose phosphorylase from Cellulomonas uda [Cellulomonas uda],3RSY_A Cellobiose phosphorylase from Cellulomonas uda in complex with sulfate and glycerol [Cellulomonas uda],3RSY_B Cellobiose phosphorylase from Cellulomonas uda in complex with sulfate and glycerol [Cellulomonas uda],3S4A_A Cellobiose phosphorylase from Cellulomonas uda in complex with cellobiose [Cellulomonas uda],3S4A_B Cellobiose phosphorylase from Cellulomonas uda in complex with cellobiose [Cellulomonas uda],3S4B_A Cellobiose phosphorylase from Cellulomonas uda in complex with glucose [Cellulomonas uda],3S4B_B Cellobiose phosphorylase from Cellulomonas uda in complex with glucose [Cellulomonas uda]
3AFJ_A	1.08e-41	837	1600	23	819	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127],3AFJ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20471	5.26e-200	7	1578	1057	2808	Cyclic beta-(1,2)-glucan synthase NdvB OS=Rhizobium meliloti (strain 1021) OX=266834 GN=ndvB PE=1 SV=2
B9K7M6	1.80e-53	837	1603	3	806	Cellobiose phosphorylase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=cbpA PE=1 SV=1
Q76IQ9	1.21e-46	837	1574	3	760	N,N'-diacetylchitobiose phosphorylase OS=Vibrio proteolyticus OX=671 GN=chbP PE=1 SV=1
Q9F8X1	2.13e-46	837	1573	3	759	N,N'-diacetylchitobiose phosphorylase OS=Vibrio furnissii OX=29494 GN=chbP PE=1 SV=1
Q8P3J4	9.55e-34	1057	1609	243	796	Cellobionic acid phosphorylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=XCC4077 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999807	0.000233	0.000004	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001237_01297.