CAZyme Information: MGYG000001237_02275

Basic Information

• Species: UMGS1600 sp900553295
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UMGS1600; UMGS1600 sp900553295
• CAZyme ID: MGYG000001237_02275
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
248	MGYG000001237_248|CGC1	27564.62	5.8574

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001237	2708995	MAG	Austria	Europe

• Gene Location: Start: 68; End: 814 Strand: +

Full Sequence      

MDRHRLPPKPRKPGKRKLPNRMPLWLTVTLCVLVLVIGGLIAAESMMRAYITQRVQERAE
AQQRVIEAYPMVYRDLIEQYAEANNLRPAYVAAIILNESSYRTDAESSVGARGLMQLMPD
TAEWIAGKLDVENYSFAMMYDAETNLRFGTWYLGYLGKLFQGDPTLVACAFHAGQGEVRG
WLSDPSLSEDGVTLKLENLADGPTKSYAGRVTRDYGIYQALYFTPPAQAAGVDPLPDADS
ALLPLASR

Enzyme Prediction     

No EC number prediction in MGYG000001237_02275.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	85	216	1.3e-21	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.99e-60	70	217	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.78e-44	68	221	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.13e-25	88	182	1	89	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	4.60e-25	42	231	107	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	2.78e-21	77	183	1	104	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUA53916.1	2.44e-74	11	234	248	476
QTE68505.1	1.03e-73	11	234	237	462
QTE71168.1	1.83e-72	11	241	242	469
QTE75132.1	1.83e-72	11	241	242	469
QUC68078.1	4.89e-72	11	237	240	463

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	6.88e-23	57	225	400	562	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	6.92e-23	57	225	404	566	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	6.98e-23	57	225	410	572	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	7.02e-23	57	225	414	576	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	7.08e-23	57	225	420	582	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	2.44e-19	67	222	474	625	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	2.44e-19	67	222	474	625	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	2.04e-18	67	222	474	625	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31976	5.36e-11	68	247	1417	1598	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	5.36e-11	68	247	1417	1598	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.819713	0.011254	0.000793	0.000091	0.000047	0.168123

TMHMM  Annotations     

start	end
21	43