CAZyme Information: MGYG000001238_01484

Basic Information

• Species: Evtepia sp900758955
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Evtepia; Evtepia sp900758955
• CAZyme ID: MGYG000001238_01484
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
265	MGYG000001238_113|CGC1	29324.57	5.6142

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001238	2740365	MAG	Austria	Europe

• Gene Location: Start: 2143; End: 2940 Strand: +

Full Sequence      

MAKPTVQEVQFDSRVLGKPMKMLVYLPAAYDGATPLPVLYFLHGRSGDETILLELGIDSK
AERMIQDGAMKPVIIVCPRIENSRGINSSLSCEKIAGSGAGDFMIHLGMYEDYFIEEIVP
MVDSMFATIRDKQGRYVGGVSGGGYAALHNAFRHQDLFSKVGGHMPAIELSLEEEDRPFF
KDASIWKKYDPISIAKNTRISSDFSVYLDAGDQDEGQFYKGCALLQEILDAKGIRCQNAV
FPGHHNAAYLKSNLEKYLAFYGSPC

Enzyme Prediction     

No EC number prediction in MGYG000001238_01484.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	13	259	3.2e-42	0.9691629955947136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00756	Esterase	8.69e-19	13	254	1	239	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	3.28e-15	5	249	68	283	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
PLN02442	PLN02442	0.001	10	242	22	250	S-formylglutathione hydrolase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CUS05080.2	3.64e-28	6	261	109	334
QJB36126.1	1.90e-19	9	167	2	159
QJB42626.1	1.90e-19	9	167	2	159
ALJ59664.1	6.52e-19	5	235	145	365
QDU77222.1	9.14e-19	9	208	98	292

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7B5V_A	1.17e-17	6	243	139	365	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZN_A	1.38e-14	5	162	131	293	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6MOT_A	1.94e-10	21	176	132	284	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6MOU_A	2.06e-10	21	176	153	305	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393],6MOU_B Chain B, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6RZO_A	2.69e-09	6	181	117	283	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31471	1.06e-10	9	243	146	368	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EY13	1.22e-08	6	162	500	650	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001238_01484.