CAZyme Information: MGYG000001239_00318

Basic Information

• Species: CAG-776 sp900758895
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-776; CAG-776 sp900758895
• CAZyme ID: MGYG000001239_00318
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
871		95482.03	4.2477

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001239	1436828	MAG	Austria	Europe

• Gene Location: Start: 16289; End: 18904 Strand: +

Full Sequence      

MKIPKIKIKKKSSTKNKVKKGKKSGSKKNTILIILISLGIVVASAVLAFALYIIITSPDF
VVEELYTKEPTVLYDMNGEEITRIGNENVELVTYSDLPQVLVDALIATEDSRFFQHNGFD
AARFIRASLGQLAGQDAGGASTLSMQVIKNTYTDGSLTSGIKGIVRKFTDIYMAVFKLEA
SYTKEEIIEFYLNSQWLGGGSTNYASINGVEQGSQYFFGKSVSDLTLAEASLLVGMFNNP
SLYNPYSNPEGASNRRSTVLSLMVRHGYITEEEKEFAESVPVESLLADHSDDENTSMYQA
FIDYTLLKVEEETGDNPYQVPMEIYTTLDPSIQETLYLLETEEIYTFINDTVQFGMAVTS
TENGAVLALSGGRNYAAQGTNRAVGIEYKGIRNHIGSTAKIIFDYGPYIEYLNGSTGTLF
LDRPWSYTVGGSVVNSSRDYWGEITMRRALVNSRNIPAIQAMQQVANEVGMDQIAEFASN
LGIDYGEELYEAAGLGGSGGSNPLSMSAAYAAFGRGGIYIEPYTFTRIVYTETEEEYTHP
VERTRVMSEETAYMITDILVDAGRSGVGGNFSISGTDIAAKGGTSTIDSESAKELGIPSN
ATPNHWNITYSPDYSIALWLGYDDLRQGYLTSGTGYNPRRQIMAAVARRIYKTGSRFEQP
SGVVSATIELGTYPLQLASEHTPSSLKSTELFKAGYEPTEVSSRFDTLANPTNGTSTYDG
STIRISWDAIETPDAIDPNYLEEYFNGYFKGLYGSDYAQEYYESRISYNNSNIGTIGYQV
YLQDASGNLISLGYTTNTYFTYTATPGTDYTFVVKSAYSIFKDNMSSGLTITAQTDMDSN
IGDMVDPDDPSDNPDDGNGDDTTPPTDTGLE

Enzyme Prediction     

No EC number prediction in MGYG000001239_00318.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	78	264	2.1e-51	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	3.25e-134	90	646	3	528	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.07e-122	45	713	29	661	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.14e-87	41	722	18	790	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	8.86e-64	77	264	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG4953	PbpC	4.68e-55	43	621	10	534	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFF98737.1	1.99e-138	56	728	57	717
ALC85822.1	2.17e-136	31	728	32	717
QPQ36371.1	2.45e-134	56	738	63	738
QJS19460.1	1.01e-133	56	801	50	789
AUS86165.1	3.14e-132	15	738	18	738

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DWK_A	8.07e-74	70	663	7	602	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	1.11e-68	57	663	3	611	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3ZG8_B	2.07e-46	177	659	2	465	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	5.99e-42	177	659	2	465	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
2ZC5_B	2.37e-40	294	624	1	338	ChainB, Penicillin-binding protein 1A [unidentified],2ZC5_D Chain D, Penicillin-binding protein 1A [unidentified],2ZC6_B Chain B, Penicillin-binding protein 1A [unidentified],2ZC6_D Chain D, Penicillin-binding protein 1A [unidentified]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39793	3.94e-105	10	706	17	699	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
Q04707	2.20e-80	38	624	18	601	Penicillin-binding protein 1A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ponA PE=1 SV=2
Q8DR59	1.55e-79	38	624	18	601	Penicillin-binding protein 1A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pbpA PE=1 SV=1
Q00573	2.56e-79	51	624	33	602	Penicillin-binding protein 1A (Fragment) OS=Streptococcus oralis OX=1303 GN=ponA PE=3 SV=1
P38050	3.03e-65	40	670	15	619	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999912	0.000101	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
31	53