CAZyme Information: MGYG000001240_00074

Basic Information

• Species: Prevotella sp900557405
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900557405
• CAZyme ID: MGYG000001240_00074
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326	MGYG000001240_1|CGC1	36996.98	8.0295

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001240	2497614	MAG	Austria	Europe

• Gene Location: Start: 106873; End: 107853 Strand: -

Full Sequence      

MKKLYLTLLLTAACITTAFAANKYDNPDTLFVARDGTAEFRNIDDAIEVCRAFMEYHKVI
YVKKGTYKEKLVIPSWLTNIEICGEDAENTIITYDDHANIFIPGTNRKMGTFRTYTVQVN
GNNITFRNITIENNAARLGQAVALHTQGDRLVFINCRILGNQDTIYTGGINTRLFFKDCH
IEGTTDFIFGPSTAWFENCTILSRINSYITAASTPQNIKYGYIFNRCRIEAAEGVDKVYL
GRPWRPYAHTLFMNCSLGKHILPAGWFNWSNPENENTARYCEYNNHGDGAATGNRVAWSR
QLSKKEAAQVTIENVFKQKDSWIPAI

Enzyme Prediction     

No EC number prediction in MGYG000001240_00074.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	31	317	2.4e-100	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	6.81e-77	32	314	4	293	Pectinesterase.
PLN02773	PLN02773	1.29e-69	30	309	7	289	pectinesterase
PLN02432	PLN02432	1.68e-62	32	308	15	278	putative pectinesterase
PLN02682	PLN02682	2.03e-60	20	324	61	368	pectinesterase family protein
COG4677	PemB	1.17e-59	32	317	87	403	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84477.1	4.71e-173	20	326	19	325
QVJ81978.1	2.00e-164	1	324	1	322
ADE82952.1	2.00e-164	1	324	1	322
QJR97878.1	1.21e-157	21	324	13	318
AGB28242.1	5.89e-157	1	325	1	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	5.84e-43	32	325	11	310	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	8.32e-42	32	298	7	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	4.92e-38	30	295	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.64e-37	30	295	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	1.99e-33	40	326	18	341	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41510	9.23e-53	29	314	272	565	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q5MFV6	3.75e-51	29	310	276	562	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
Q9LVQ0	4.15e-51	32	307	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q42608	1.51e-50	29	314	259	552	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1
Q9FJ21	1.10e-49	16	324	246	560	Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana OX=3702 GN=PME58 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000588	0.984792	0.013855	0.000283	0.000225	0.000206

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001240_00074.