CAZyme Information: MGYG000001240_00177

Basic Information

• Species: Prevotella sp900557405
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900557405
• CAZyme ID: MGYG000001240_00177
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
699		78285.98	8.2545

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001240	2497614	MAG	Austria	Europe

• Gene Location: Start: 42546; End: 44645 Strand: -

Full Sequence      

MKSNLIPSGRFAWMAAALAFAALPACAQKNGITDTGKSKYAVVTSTPISSVKWTGGFWGD
RFGVFAGTSVQSMWETWKSDKGHGWNNFLIAAGEKKGKRHGPPFHDGDMYKWLEALTAVY
AVNKDPEVGKIMDRFVELIRKSQRPDGYLHTPVIIAEMNRQQTAKDEAKENETIGTKVGT
GKDGAFGNRLNFETYNLGHLITAGIMHKRATGKTTLFECAVKATDFLYDFYKRASDELAR
NAICPSHYMAVAEMYRETGNPKYLELAQKLIDIRGKVENGTDDNQDRVPFRQQYNAMGHS
VRANYLYAGVADLYLESGEQQLMKNLESIWTDIVTRKMYITGACGALYDGTSPDGTDYKP
DNVQKVHQSYGRPYQLPHSTAHNETCANIGNLFFNWRMFSATGEAKYTDIVENCLYNSIL
SGISLDGRKYFYTNPMRISKDLPYTLRWPKERTEYISCFCCPPNTLRTLCEAQDYAYSIG
KGEIYVNLYGENTLDTRIDGIGEIALKQKTDYPWDGSVGITIAKLKGKKEFGMKLRVPDW
CTEGARISVNGVEQAAEAKPGTYATVSRTWKKGDVITIDMPMRTRIIEANPLVEESRGQV
AVQRGPIVYCLESNDLNGVSIDDIAIPLNAEFTPVDMTIDGCRIKALEGDVVKRSEASWK
GQLYREASTGKQTVRVRLIPYYAWGNRGKSEMTVWMPAL

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	51	610	1.3e-184	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	50	610	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.30e-134	55	698	20	587	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUR43102.1	0.0	25	697	18	695
QRN01927.1	0.0	25	697	18	695
QDH55672.1	0.0	25	697	18	695
QCD40914.1	0.0	23	697	16	692
QUT38421.1	0.0	25	697	18	695

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQO_A	0.0	25	697	18	695	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QJY_A	8.52e-120	57	696	22	645	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.68e-115	57	696	22	645	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	1.97e-113	43	697	7	624	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
7EXU_A	2.23e-84	81	694	50	654	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	2.58e-83	81	694	50	654	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000206	0.183779	0.815722	0.000112	0.000092	0.000073

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001240_00177.