CAZyme Information: MGYG000001240_00941

Basic Information

• Species: Prevotella sp900557405
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900557405
• CAZyme ID: MGYG000001240_00941
• CAZy Family: GT2
• CAZyme Description: putative protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333		37862.62	6.6656

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001240	2497614	MAG	Austria	Europe

• Gene Location: Start: 30175; End: 31176 Strand: +

Full Sequence      

MMEDKISVIVATYNQEDTIARTLDSILMQCCHLPIEIVVGEDCSTDSTRTVCESYAQRCP
HIVCLMPKAPNKGMIRNYYDCLMACRGKYIADCAGDDFWTDPEKLEKELRIMEEHPTVTL
VHTNWRFYNEDTLNTKDNTYVPFPALITKGTDILEAVITQTTAPVVHTCTALYRADVIKR
CYDEDPELFRNPDNGCEDLQLVCMLAANGDVAYLPDHTLNYSVGRPSVSFQPDDRRQFRF
VSRTASLSFRLAGMFGINTPITRKFFADKAFALLMHAFRSHDKTLRDEACALMNTWGVKP
DIKTRAARTIMSGSPLWNILLATRKLFVALKRI

Enzyme Prediction     

No EC number prediction in MGYG000001240_00941.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	7	179	2.5e-24	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04196	GT_2_like_d	1.22e-27	7	221	1	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	5.30e-25	7	178	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	6.34e-20	8	127	1	117	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG0463	WcaA	4.11e-19	2	147	1	136	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd02525	Succinoglycan_BP_ExoA	4.81e-13	5	214	1	199	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO49672.1	2.31e-103	2	316	1	312
QCD36002.1	3.89e-77	2	318	3	323
BBO81312.1	1.86e-35	6	222	6	219
BAD49325.1	8.03e-30	6	216	11	204
AOM80569.1	3.01e-29	3	136	6	141

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	8.02e-06	6	131	7	127	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P64864	4.10e-23	7	142	2	135	Uncharacterized protein Mb1547 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1547 PE=4 SV=1
P9WLV4	4.10e-23	7	142	2	135	Uncharacterized protein MT1570 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1570 PE=4 SV=1
P9WLV5	4.10e-23	7	142	2	135	Uncharacterized protein Rv1520 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1520 PE=1 SV=1
P71054	7.14e-13	5	158	6	158	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2
P22639	1.01e-09	5	223	2	209	Uncharacterized glycosyltransferase alr2836 OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=alr2836 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001240_00941.