CAZyme Information: MGYG000001240_01061

Basic Information

• Species: Prevotella sp900557405
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900557405
• CAZyme ID: MGYG000001240_01061
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
705	MGYG000001240_26|CGC1	81045.98	4.9272

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001240	2497614	MAG	Austria	Europe

• Gene Location: Start: 16771; End: 18888 Strand: +

Full Sequence      

MEMENKATWIWYPGDFEVWLGNGFNNRRTERGAMFPPFWKQDSHYVTVEFSTKVNLEKPE
TITIAAEGDFNLMLDGKLQFGMPGKFTVPAGEHSLNFKIHNQSTPPALYVKGRTIKSGSG
WLATYEDKIWIDENGVAHGSGIYVPAASWTFDNIDTPPSQYKLKRTEMPPVDEEKTGANK
WLFDFGLETFGYVRLKGVKGKGIINIYYGESREEALDMEYCETLDRLDLRSNEYENEEVE
IVLDDSKAFRYVMVETKGMITYSDVSMDYEYAEFTHGKSGSFKSDNRELNRIWEVAAYTM
DLTTREFFMDGIKRDRWTWSGDAIQSYLMNYYLRFDSDCVRRTIRQLRGKDPVTAHVNTI
MDYTFYWFKSVLDFYQYTGDIAFVREIYPRMQTLMQYVMGRLNNEGMAEGKADDWIFVDW
VDFPMHKRGILCFEQILLCKAFETMHTCAAVLRDNPLANPPQGSIATEEYAADADRYGKL
AADLKAKLKPTFWDKDRNAFMHAIEDGEMNRQITSFPNMFAIIYDMVDQEDKEKLMDSVL
LNRDVEPITTPYMRFYELEAMCRMGYQERVLPEILGYWGGMINEGATSFWEKYNPADEGA
GHLAMYGRPYGKSLCHAWGASPIYLIGRYYLGVSPTKPGYAEYEVKPVLGGLKRMQGSVP
TPFGEIRVKMDGRTVSVKSDGGRGTLVVGGKTYDIPAGQELKIEY

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	175	671	3.7e-105	0.9503968253968254

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.50e-19	280	629	4	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.31e-04	632	669	1	39	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam06202	GDE_C	0.001	358	552	81	267	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
pfam05592	Bac_rhamnosid	0.005	175	255	2	85	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ48848.1	4.65e-301	8	705	22	700
QUT45325.1	3.79e-300	8	705	22	700
QUT58576.1	5.52e-296	5	705	19	714
ABR40300.1	5.52e-296	5	705	19	714
QQY37560.1	5.52e-296	5	705	19	714

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	3.60e-277	8	688	19	694	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	2.33e-37	115	664	377	910	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	1.74e-30	240	629	164	541	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	3.46e-15	249	666	700	1108	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2
P9WF03	1.11e-08	281	677	471	866	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001240_01061.