CAZyme Information: MGYG000001240_01107

Basic Information

• Species: Prevotella sp900557405
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900557405
• CAZyme ID: MGYG000001240_01107
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1321	MGYG000001240_28|CGC1	148810.95	7.5396

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001240	2497614	MAG	Austria	Europe

• Gene Location: Start: 18958; End: 22923 Strand: -

Full Sequence      

MTGIKYKIALMPLLLTALLSTTPAIHTDAAKNRKATTEKAEGTKAVKLLTENMKTPLGLG
TRTPRFSWQIQSGKNSTIQTAYRILVASSREMLAEGKADLWDSGTVSSNEQLWIPYSGAK
LKDNQRAYWTVRVTTNNGNSEWAEPQLFSTGIIGEEHWSGRWIGIDELDKGESMGFKTRV
NARYLRTEIELEHGKKIKQATAYVAALGLYELYVNAQRQGTDVLAPQQTDTRESIIYNTL
DITNSLAKTEKQGKACVGIILGNGRTVPMRYDKHWKTPFMGFPKCRVMIVVEYDDGSSRT
FSSSEKWKATTAGPIRSNNEYDGEVYDARMELGNWSYPGYDDSAWRNADRASIPTGELRG
QPAPNMKILSRLKPQSIKRTGRGTFIVDFGQNMAGWVQMKMRGNSGDTIKIKYAEKLDDN
GELFIANLRDAETEDKYVCSGNEKGRAWHPTFVYHGFRFVEIKGAESVAATDVEAQVVAD
EMESIGSFHTNNDILNGVYKNAWWGILSNYKGFPTDCPQRNERQPWLGDRVMGCLGESFL
FNNERLYTKWMRDICESQRSDGVLCDVSPAYWSYYNDDITWPSALPFGCDMLYTQFGNSE
AAIASYPALKKWVGHVVDEYMKDGIIEKDKYGDWCVPPEDLALIHSKDPARQTDGRLIST
AYMIRNMRLMQKFARIAKQEGDVPYYSELEKRMTEAFNRKFLFVKRGTSVRHDHVLYPDS
VFYCNNTATANLLPLALGIVPDSCKEDVVRNVVANIMTANKGHVPCGVIGISWLMRGLSE
NGFADVAYMLATNDTYPSWGYMLRHGATTIWELWNGDKANPWMNSGNHVMLLGDLLPWCY
ENLGGIKNAKGSAGYRNTVMKPNFEIEELDSVDVSYETPYGRIKSAWNKDLETLHWNIEV
PVGITAEVCLPNGETKTVGSGKYTFNCKYSFADKRVIKDEFVYKQTDFPQCHASSIVELD
NGDLVATYFGGTKERNPDVCIWVNRKPKGSDKWSEPQLVADGVFKLGTEEARIARMDTTC
AKAETGPIVGVNKTWAESKKDSIPTGLYRKACWNPVLFEMPNKELWLFFKIGWVMNDWTG
WVVKSKDGGRTWSKKEPLPEGFQGPIKNKPVVVGERLICPSSTENEGGWKFHFEIMDLNT
GKWKYVGPIEREMRPLTVDMNPDGTLITGDTIEHKLNPIYCIQPSILKLKDGRLQAIGRT
KNGRLASTWSSDNGDTWSKVTLIDVPNNQSGTDALTMSNGKHVLIYNDFATIPGTPKGPR
NPVSIAVSDDGLKWEHIITLEDSPIGDYSYPAIIQAKDGTLHCVYTWRRFRIVHKQIDLN
R

Enzyme Prediction     

No EC number prediction in MGYG000001240_01107.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	377	910	3.9e-150	0.998015873015873
GH33	935	1305	1.7e-31	0.935672514619883
CBM67	162	351	6.2e-27	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	7.11e-119	486	843	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam13088	BNR_2	8.19e-84	962	1303	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam08531	Bac_rhamnosid_N	1.20e-52	195	368	1	170	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
cd15482	Sialidase_non-viral	6.65e-38	941	1318	4	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam05592	Bac_rhamnosid	9.68e-35	378	478	1	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84864.1	0.0	50	1321	13	1269
QNT66960.1	0.0	10	1321	6	1326
QNL37629.1	0.0	48	1318	29	1284
QIU95828.1	0.0	48	1318	29	1284
QGT69954.1	0.0	48	1321	27	1285

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	3.51e-165	56	911	43	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.58e-115	51	911	12	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	6.49e-96	51	928	10	866	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
2OKX_A	1.42e-10	340	923	398	954	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4X6K_A	2.38e-06	1085	1317	240	471	Crystalstructure of the intramolecular trans-sialidase from Ruminococcus gnavus in complex with Siastatin B [[Ruminococcus] gnavus CC55_001C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	6.56e-127	47	925	34	921	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	6.35e-123	49	938	40	910	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	3.38e-117	51	911	38	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	6.65e-115	51	911	12	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KM26	2.34e-23	297	916	513	1142	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004708	0.993772	0.000731	0.000301	0.000229	0.000225

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001240_01107.