CAZyme Information: MGYG000001242_01117

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000001242_01117
• CAZy Family: GH18
• CAZyme Description: Chitinase A1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370		40171.71	4.9917

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001242	2074674	MAG	Austria	Europe

• Gene Location: Start: 8434; End: 9546 Strand: -

Full Sequence      

MRRLIPALCVVLFASVASMPPVTAGASDDEALNASAVITGADALAAAAPVDEPADPMDGD
HIVVAYFTSWSTCTPDPVYMTHINYAFGHVSDSFNSIGIDNPDNLRKVVRLKKYKPELKV
LLSIGGWESGNFSELCADAGCRKAFALDCRRVLDEYGIDGIDIDWEYPGSSVAGISSSPD
DPANFVLLLKEIRGSLRDGELLTLASDATGLGLRFKDLLPYVDFINIMAYDLAEPPRHHA
PLFRSSALGGHMTAAESVDKHLNAGVPADKLVLGVPFFGRGSGAYKYSEPYSSILCRPGC
NMCWDDTAKAPYIADSTGAVVLGYEDARSITCKRDFIKEKGLRGIMYWEYRYDDSNNTLR
RAAAGMLKMR

Enzyme Prediction     

No EC number prediction in MGYG000001242_01117.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	62	359	5.6e-66	0.9527027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	2.10e-92	63	353	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	3.51e-81	63	353	2	334	Glyco_18 domain.
pfam00704	Glyco_hydro_18	4.59e-77	63	353	2	307	Glycosyl hydrolases family 18.
cd02872	GH18_chitolectin_chitotriosidase	9.91e-68	63	358	1	346	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
COG3325	ChiA	4.70e-55	62	365	39	438	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT34049.1	2.44e-112	49	367	34	354
QUT34047.1	1.21e-110	51	361	25	333
ADV45176.1	9.64e-110	51	361	25	333
SCD19272.1	1.75e-108	62	362	36	336
QDO71383.1	1.66e-107	62	361	34	332

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6INX_A	9.23e-57	80	359	27	335	Structuralinsights into a novel glycoside hydrolase family 18 N-acetylglucosaminidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
6TSB_AAA	1.04e-48	49	366	24	350	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	1.62e-48	49	366	43	369	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
1ITX_A	6.81e-47	63	359	14	411	ChainA, Glycosyl Hydrolase [Niallia circulans]
6KST_A	9.34e-47	59	367	5	371	Crystalstructure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	2.00e-44	63	359	46	443	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
P48827	2.39e-35	81	366	85	401	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1
P32470	4.60e-35	81	349	85	379	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
Q873X9	4.85e-32	64	357	46	393	Endochitinase B1 OS=Neosartorya fumigata OX=746128 GN=chiB1 PE=1 SV=1
E9QRF2	4.85e-32	64	357	46	393	Endochitinase B1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chiB1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000555	0.998583	0.000232	0.000237	0.000186	0.000169

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001242_01117.