CAZyme Information: MGYG000001242_01243

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000001242_01243
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378		41605.12	9.4272

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001242	2074674	MAG	Austria	Europe

• Gene Location: Start: 9913; End: 11049 Strand: +

Full Sequence      

MHYFLIAGEASGDLHASQLIQQLAAGDPHAKFTFLGGDLMAEAAEHAPLIHYREMAYMGF
SEVLRNLGKVRANLAAARRAVTESRPDALILIDYPSFNLKVAETAAKADIPVYYYISPKI
WAWKQWRVKAIKRLMRRVLCILPFEPEFYRAHGYERAIYTGNPSVEEIESALGAAPSREE
FAKAHGLRTNRPFIALLPGSRRGEIRCNLPVMDAVARQFPGYTIAVAGAPAIDDSVYAGL
TKFKIVRSATHDLLAHAQAALVTSGTATLEAALAGVPQVVMYRSNGSKLAYNLMKKLLKV
KFVSLPNLIADRGIIPEMLLHHCTPEAVADHLRQLTPDRSPERAAQLEGYREMRETLGPP
GASARAAAIIINDLNNEK

Enzyme Prediction     

No EC number prediction in MGYG000001242_01243.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	357	9e-110	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	5.40e-106	1	357	2	359	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.62e-101	4	358	5	363	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	9.37e-80	4	329	2	332	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.39e-68	5	361	10	373	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	8.96e-52	1	327	2	308	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR08529.1	3.75e-136	1	378	1	377
ASB37800.1	3.75e-136	1	378	1	377
ANU64105.1	3.75e-136	1	378	1	377
QCD36425.1	2.93e-134	1	378	1	378
QCP71596.1	8.85e-118	1	371	1	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	6.82e-36	5	370	11	378	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	6.82e-36	5	370	11	378	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.45e-75	5	371	9	375	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
B3E4H8	6.53e-67	5	372	11	378	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q2IL69	1.01e-65	5	371	13	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
B8JE78	2.01e-65	5	371	13	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
B4UHR6	2.83e-65	5	371	13	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001242_01243.