CAZyme Information: MGYG000001244_00476

Basic Information

• Species: UBA737 sp900549055
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA737; UBA737 sp900549055
• CAZyme ID: MGYG000001244_00476
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
718		78644.33	9.1424

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001244	1748444	MAG	Austria	Europe

• Gene Location: Start: 6007; End: 8163 Strand: +

Full Sequence      

MANNIYVIIPSLNPDEKLKNTVRGMLDAGFERIIIVNDGSDNEHLENFPHSDENITVIHR
RQNHGKGAALKVAFRHILRNCPDAAGVVTVDGDGQHSPQDAAACAAALDGIGKGAVLGCR
DFSGEDVPKRSRMGNHTTSFVFKVLCGMEISDTQTGLRAFPVSLLPLLLSVKGDRFEYET
NMLLKFRQCGVKIKEVPIETVYIEENATSHFRPIQDSLRIYRFLIVYFLSSAISFVADLS
VFYLAMKLLGASLGKWAELTATAIARAISSVINYNINRTKVFNADSKSHGKLARYYALAI
PQMFISAGLVTLVSHLLKATPFLATVIKLIIDTVIFFVNYRIQQTWVFAETKENKSAGKK
SGKKLTAGTVVKRTLLSVGTALAMVLVFVISAALMICYGPSKSLRNMTVIMAKEASATKW
IPTLFLPASTVNRIIADSEKVNVDVIDTDDYGKTAADEWDDAVDGMKLIYLNEPKFKGYI
LLIRDPKRVSVGTSSENYASAAAGARIFDIAQKYNCIAAINGGEFADAGGQGTGAKPMGL
TYSGGKNVWNDGLKRSFFGFDKNDRLVCREGMTKAEADKLGIRDAVSFQTGNVLIQQNGE
DIKLFHADSDTGTAQRTAIGQRADGTVILLVTDGRSVDSIGATRNDVIDLMVSYGAVNAG
MLDGGSSAMMYYRNYFDKYSIDKSQLDSYQLKGLVNRYKAFTNPRRIPTYFIVSEEKK

Enzyme Prediction     

No EC number prediction in MGYG000001244_00476.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	7	136	2.4e-17	0.7647058823529411

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09992	NAGPA	9.52e-34	514	713	1	168	Phosphodiester glycosidase. This is a family conserved from bacteria to humans. The structure of a member from Bacteroides has been crystallized and modelled onto the luminal region of the human member of the family, the transmembrane glycoprotein N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase. There is some conservation of potentially functional residues, implying that in the bacterial members this family acts in some way as a phosphodiester glycosidase. The human protein is also present, so the eukaryotic members are likely to be catalyzing the second step in the formation of the mannose 6-phosphate targeting signal on lysosomal enzyme oligosaccharides.
COG4632	EpsL	5.69e-30	382	672	15	294	Exopolysaccharide biosynthesis protein related to N-acetylglucosamine-1-phosphodiester alpha-N-acety... [Carbohydrate transport and metabolism].
cd04179	DPM_DPG-synthase_like	1.30e-28	7	186	1	185	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
pfam00535	Glycos_transf_2	2.39e-15	7	145	2	140	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04188	DPG_synthase	7.45e-14	7	199	1	203	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJS17823.1	1.73e-87	3	360	5	361
ACR71698.1	6.35e-86	5	348	6	359
AGF54073.1	9.58e-83	7	348	13	355
AQR92977.1	2.80e-81	7	348	13	355
QHJ69351.1	6.78e-79	3	348	2	345

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58619	8.15e-22	3	204	17	218	Uncharacterized protein MJ1222 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1222 PE=4 SV=1
B3VA58	1.05e-18	5	204	6	222	UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminyltransferase OS=Methanococcus voltae OX=2188 GN=aglK PE=1 SV=1
O31980	1.99e-07	616	668	227	279	SPbeta prophage-derived uncharacterized protein YomE OS=Bacillus subtilis (strain 168) OX=224308 GN=yomE PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
224	246
256	274
295	317
321	340
374	396