CAZyme Information: MGYG000001244_00514

Basic Information

• Species: UBA737 sp900549055
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA737; UBA737 sp900549055
• CAZyme ID: MGYG000001244_00514
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1040		115902.06	4.83

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001244	1748444	MAG	Austria	Europe

• Gene Location: Start: 6757; End: 9879 Strand: -

Full Sequence      

MKANKDFSQKEERLNFCLDVAGEGIVLLKNEGNILPLENARLAVFGATQLGAQAANEGVK
VDTENSVGITEAFLKRGMEIDEPLYNEYCVWRRQFVQRTYGEWRNAHVFPELPITAEKAL
EAKNRGADTAVMVITRASYENSDMDIEIGDYIISETERNMIKNVCSVFENTVLILHIGCN
IDLGFLDDFDIKGIIYTNHLGVNGNLSIADIMLGKINPSGKLPVTLARHFEDYPSSANFG
QHGGGLLQDYTEDIFVGYRYFESFEKEYEKVVFPFGYGLSYTSFEITDKTFKEENGIITV
TASVKNTGEMPGKEVLQLYYSVPNKADGAYLSGAEKQLCGFEKTRLLKPGETQEISISFK
TDSMAVFDDTGVLGEKSVWVMEKGEYKIMLGTDSHNTEIIGTHTEQDTRVTERCHEIITT
LSERLTRSGKYEKLPQPNTGDGCHGISAIGKTEIKAESFNNAPEKFAGFRAGKSYTYSLL
PGTGGEYRLTFGDSAGAPNKLCDIYVNNVKINDLKPQNGSVVLNLPLERCTLTLKPQTDF
AAESLIFEKTDVKTVIHKDGINTVEAANMYECDFKITTANYEDDGLGHGGSYVTDFEFAG
KFVTYKLEVEEAGNYAISFKYAYSGEDRPMNTVMTVLASNIVQPLGGNILKRTYSDGEPK
RFITSDRFAISLPQGKVYLKIAAENVPFPDISLIYLEKAECEITAADISLDDIRERNSQF
QAIPRRKLIDDPANYPKKGIQLSEVYREPELMKPFLEQLTNRELATIVSGTTNNLTPGGD
VGCNSPLHERGVPAAQTADGPCGLRQFDQIPIAFPVGMVLSATFNKELFADYGLCMAEEC
LEYSVDYLLGPSINIIRNPAGGRNCSYHSEDPYLAGITAAYYIKALQSKGIAAVLKHYTA
NSTEFERLKSNSRVSARALREIYLKAFEIAVKESDPWGMMSSYNHVNDKKVCEDYTLITE
IPHIEWGWNGIFMTDWWNDSKHSEELKAGHDLKMSTGDIEGVTQALESGELTREQVYVCA
ERVLKTLMKIGRIKNKFEKN

Enzyme Prediction     

No EC number prediction in MGYG000001244_00514.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	790	994	4.2e-47	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.00e-37	791	1036	59	321	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK15098	PRK15098	2.62e-31	19	398	389	758	beta-glucosidase BglX.
pfam01915	Glyco_hydro_3_C	1.07e-30	25	258	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	5.99e-24	738	1024	5	314	Glycosyl hydrolase family 3 N terminal domain.
pfam14310	Fn3-like	3.43e-17	314	394	1	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL32888.1	1.30e-108	11	1030	26	824
AOZ95010.1	7.76e-108	12	1030	26	802
CBL07465.1	1.58e-106	19	1030	34	804
QAA32414.1	1.66e-106	19	1030	34	806
VCV20357.1	4.25e-106	19	1030	34	804

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUG_A	8.07e-88	21	1028	44	820	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
2X40_A	8.72e-58	750	1035	2	312	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	9.66e-57	750	1035	2	312	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
5WAB_A	1.76e-47	754	1016	7	274	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
7MS2_A	2.53e-44	752	1027	5	286	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16084	1.41e-99	11	1016	26	810	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
P15885	1.46e-91	12	1028	8	763	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
F6C6C1	2.25e-49	754	1016	7	274	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	3.01e-49	754	1016	7	274	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
Q5BFG8	4.85e-45	748	1035	7	294	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001244_00514.