CAZyme Information: MGYG000001244_01554

Basic Information

• Species: UBA737 sp900549055
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA737; UBA737 sp900549055
• CAZyme ID: MGYG000001244_01554
• CAZy Family: GH116
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
833		94172.11	4.8883

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001244	1748444	MAG	Austria	Europe

• Gene Location: Start: 98; End: 2599 Strand: +

Full Sequence      

MKEYIGDNINQIAFPLGGIGTGSISLAGNGAIVDPEINGHPDREKDCGFTNFAIKAESDG
KVTDSRLLCGDFIHDYMGTIRGSYGEGNSALSGFKHFEKCIFKGEFPFARIELTDSAFPA
EVVLEAFNPFIPSNDKDSSIPAAFFTFNIKNISDSKIKYTVLGTVSNLLKNGGLNRYTEK
SGIKMITLNGASDKNRDDSITIATDAENTAHQDYWFRGGWFDTLTMFMNELNTEGTVTER
TYDTENPNGRGDAATLTAAVELEPGEIKTIKFLISWYVPKFDIEEFHFGPSRKTEGIKNY
YASLFENSETGALYAFCNWQRLFSDTEKFSTAMYSSSLPEEVKEAIQGNLAILKSTTCLR
LEDGSFWAWEGVHRNVGSCAGTCQHVWNYAYALPFLFPNLEKGIRTNEFKNSLSKDGMMD
FRLLISMDGTSWGARSCVDGQMGNVVKCYREWKISGDDEWLKANWENIKKSIEYAWSEEN
FDKWDPNKSGVITGRQHHTLDVEMFGLYSWLTGFYHAALLAGAEMAEYLGEEKTAKEYRS
LFEKGRITLDETFNGEYYEQYVDITDKSMLENYNGAEHYWDKETKQIKYQICSGCGIDQV
LADWHTSLVGLPNVFVKEHRKSALEAIYKYNFVKMHDNHNPCRVFACNDEKGVTMFRWPD
IERKPKIPVPYSEECMTGFEYAVADNMLQCGMEDKALEIVRAIRERYDGKKRNPWAEIEC
GASYARAMASYSFLLTYSGFIFDMPKKRIGFKPIRNGKYFWSVDGAWGTANCSDKCCEFT
VLYGEIELKSFVTALSSVSSVLINGNDVNFEKDGEAVIINCALKENDTLIILK

Enzyme Prediction     

No EC number prediction in MGYG000001244_01554.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH116	364	733	1e-58	0.9944903581267218

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12215	Glyco_hydr_116N	7.85e-50	13	322	1	309	beta-glucosidase 2, glycosyl-hydrolase family 116 N-term. This domain is found in bacteria, archaea and eukaryotes. This domain is typically between 320 to 354 amino acids in length. This domain is found associated with pfam04685. It is found just after the extreme N-terminus. The N-terminal is thought to be the luminal domain while the C terminal is the cytosolic domain. The catalytic domain of GBA-2 is unknown. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335 in the downstream family pfam04685.
pfam04685	DUF608	5.44e-43	364	733	1	362	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
COG4354	COG4354	1.28e-41	15	741	16	721	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].
pfam17389	Bac_rhamnosid6H	5.92e-06	448	572	107	229	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUH30377.1	1.74e-283	1	833	1	864
AEE95836.1	2.02e-270	4	824	8	867
QHT59778.1	5.46e-261	2	833	3	864
AZN43107.1	1.29e-259	2	833	3	864
QGQ98507.1	1.11e-258	3	831	5	864

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7KT91	2.80e-09	99	698	220	893	Non-lysosomal glucosylceramidase OS=Drosophila melanogaster OX=7227 GN=CG33090 PE=1 SV=1
Q5M868	8.51e-07	15	692	144	828	Non-lysosomal glucosylceramidase OS=Rattus norvegicus OX=10116 GN=Gba2 PE=2 SV=2
Q9HCG7	8.55e-07	15	692	153	837	Non-lysosomal glucosylceramidase OS=Homo sapiens OX=9606 GN=GBA2 PE=1 SV=2
Q69ZF3	1.93e-06	15	692	144	828	Non-lysosomal glucosylceramidase OS=Mus musculus OX=10090 GN=Gba2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.990385	0.009446	0.000127	0.000015	0.000010	0.000024

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001244_01554.