CAZyme Information: MGYG000001247_00315

Basic Information

• Species: UMGS1370 sp900542035
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS1370; UMGS1370 sp900542035
• CAZyme ID: MGYG000001247_00315
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	MGYG000001247_1|CGC5	37215.69	4.1443

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001247	2761406	MAG	Austria	Europe

• Gene Location: Start: 320214; End: 321233 Strand: -

Full Sequence      

MNMNLVTGKSRKYRLTAVLLASGLLCTPASVTAAAGTSEIGPGVGLETADGLNRDYTVSE
NGAFTKVNGQYVNSEGAVIEGALSRGISVSKYQQDIDWVAAASDDISFTFIRMGYVDDLD
PYFDVNMREAAAAGIQVGTYLYSQALTVEDAVREAQFAVRTAKEYKVSYPIAMDVESKVV
EEAGLTRQQLTDIVNAFCSTVEAAGFKPIVFSYNDWLTNKMDTSQIPYDIWYARYGTINS
YPNRTIWQCTDSGNVKGIEGPVCLELAFTDYSQIIPSAGWKQIDGAWYYFEDYQKITGWK
QLGETWYYLDPANGGIMAADTTLTIDGTPYQFDASGAMM

Enzyme Prediction     

No EC number prediction in MGYG000001247_00315.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	87	258	3.6e-42	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	3.54e-70	85	268	2	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	7.22e-34	85	262	1	181	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	1.02e-27	87	258	1	180	Glycosyl hydrolases family 25.
cd06413	GH25_muramidase_1	4.34e-23	85	262	4	184	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06525	GH25_Lyc-like	4.01e-21	85	260	1	177	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK77574.1	4.68e-142	63	339	37	311
ASN93256.1	1.85e-100	68	325	89	349
QRP42084.1	1.85e-100	68	325	89	349
QJU22303.1	4.49e-100	68	323	95	353
SET59461.1	2.32e-99	68	339	39	315

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAG_A	1.45e-07	85	260	17	196	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
3HMC_A	3.48e-07	87	258	8	171	Endolysinfrom Bacillus anthracis [Bacillus anthracis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76421	7.41e-10	86	262	69	249	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8FFY2	1.35e-09	86	262	69	249	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000365	0.998743	0.000230	0.000239	0.000201	0.000167

TMHMM  Annotations     

start	end
13	35