CAZyme Information: MGYG000001247_02237

Basic Information

• Species: UMGS1370 sp900542035
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS1370; UMGS1370 sp900542035
• CAZyme ID: MGYG000001247_02237
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	MGYG000001247_21|CGC1	41364.58	4.7411

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001247	2761406	MAG	Austria	Europe

• Gene Location: Start: 48074; End: 49147 Strand: +

Full Sequence      

MSVYENRLNLVADAMLTMKNNGIEEKFPISLIDIDCWEWPQGVGLYGLYKYYEFSKDEKI
LNFLIQWFDDRIKEGILEKNVNTTAPMLTLSYIYEITGKEEYLDLIKEWTAWIMEEKGLI
RTGDGCFQHMITKNPNQGEILIDTLFMTVLFLARAGAILNRKDCIDEANYQFLLHIKYLL
NKQEGLFYHGFNFDRNNNYGEIMWGRGNSWYTVAIMDYMEMVDLDAGLKRHFLTVYENQV
KALKKYADPEEGLWHTVINDSSSYIELSASAGFLCGMMKGIRKGVISKDEYGDTVQKALS
HLLDYIDEKGVVKNVSYGTPIGENAEFYKNIICCPMTYGQAMMIMALQEAMRYTTER

Enzyme Prediction     

No EC number prediction in MGYG000001247_02237.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	36	352	4.9e-96	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	8.87e-95	5	352	6	351	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.67e-81	13	353	5	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ94867.1	1.58e-189	8	351	11	354
SET87383.1	1.24e-170	5	351	8	354
AGX06452.1	1.76e-134	5	357	9	358
ANY67857.1	8.51e-134	7	354	10	353
APO45381.1	1.97e-132	3	355	6	354

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PMM_A	2.97e-84	37	352	66	379	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	6.48e-83	37	352	65	378	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	4.93e-71	7	352	11	370	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4WU0_A	7.24e-24	35	304	21	300	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3K11_A	1.89e-10	121	328	183	387	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	6.84e-47	37	331	29	315	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001247_02237.