CAZyme Information: MGYG000001248_00251

Basic Information

• Species: Dialister sp900543165
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister sp900543165
• CAZyme ID: MGYG000001248_00251
• CAZy Family: GT9
• CAZyme Description: ADP-heptose--LPS heptosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364		40510.78	7.3334

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001248	2225809	MAG	Austria	Europe

• Gene Location: Start: 87683; End: 88777 Strand: +

Full Sequence      

MNLKDKNIVIIYMLYFGDMVSLSPFLEILRREAVGSKITLVIDARFQESVRYNPCIDTII
PVDRKKMGLSATWKLGKEIGKTHPDILMVLHGTTRTFLMAKAMKAKVWVGETGNPLGRLF
IDDEILVERRDCHAAEKYVKVLEHLGVSNLAHHGMQMYTCPAWEEGAKAFFISEGVKLGD
RLAGFSVGSSTPEKNWPAEKYGEVADHFAGLGYRPVFLGIPSEMPLIEKALAHMKCRDEA
IVAAGKLSMGEFIAAASWCSVAFTNDSGPMYVFDSRKVPVIAMFGPSNAKLHHPLGEKSC
ALATTDMPRTQDHVNHTIRDRSYTPIDAISVDDAIRAGEWALGRRSDERYEGHLVFVEGN
QHKT

Enzyme Prediction     

No EC number prediction in MGYG000001248_00251.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	73	305	1.5e-37	0.9022222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	2.78e-41	7	337	1	274	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	3.67e-37	6	337	2	325	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	4.22e-20	73	298	2	223	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	6.07e-11	1	339	1	340	lipopolysaccharide core biosynthesis protein; Provisional
PRK10916	PRK10916	8.27e-08	184	299	184	302	ADP-heptose--LPS heptosyltransferase RfaF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK25206.1	2.89e-146	2	342	9	351
AXB80808.1	2.81e-89	2	344	3	344
AXL20515.1	2.25e-87	2	348	3	348
AVO27634.1	5.94e-85	2	349	3	349
CCC73399.1	5.94e-85	2	349	3	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	1.68e-67	2	342	5	345	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000020	0.000021	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29