CAZyme Information: MGYG000001248_00743

Basic Information

• Species: Dialister sp900543165
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister sp900543165
• CAZyme ID: MGYG000001248_00743
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
198		22582.02	6.8788

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001248	2225809	MAG	Austria	Europe

• Gene Location: Start: 5550; End: 6146 Strand: +

Full Sequence      

MRTALKRKKREVHRHQGNTGAMLFTLLLAILCGLVLYILSDISFMRPSREISLLISESAK
KEEISPALLEAVILTESKFDKKAVSHVGAIGMMQLMPDTAEWISEESGLPANRLERPEEN
IPLGAWYINYLLKEYHNNEVLALAAYNAGRGNVDQWMKDYGWKEGFSDLNQIPFPETREF
VKSVSAARDRLEKERTEK

Enzyme Prediction     

No EC number prediction in MGYG000001248_00743.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	58	195	1.8e-29	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	2.06e-71	54	190	7	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	5.50e-53	54	186	9	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	4.09e-42	66	187	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	4.80e-33	55	166	1	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	4.84e-29	21	198	93	290	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK24355.1	6.52e-102	1	198	1	198
AOH39655.1	8.06e-61	17	194	13	189
CCC73618.1	2.06e-47	54	184	13	146
ALG43012.1	3.86e-47	12	184	1	178
AVO73570.1	5.47e-47	54	184	45	178

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	9.84e-22	59	186	424	550	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	9.88e-22	59	186	428	554	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	9.94e-22	59	186	434	560	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	9.97e-22	59	186	438	564	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.00e-21	59	186	444	570	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	3.18e-19	55	186	64	177	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P39434	1.94e-18	54	186	483	620	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	2.25e-17	62	186	491	620	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	2.25e-17	62	186	491	620	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
O64046	3.08e-16	55	186	1426	1539	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000021	0.000028	0.000000	0.000000	0.000000	0.000002

TMHMM  Annotations     

start	end
20	39