CAZyme Information: MGYG000001248_01841

Basic Information

• Species: Dialister sp900543165
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister sp900543165
• CAZyme ID: MGYG000001248_01841
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
307		33662.56	6.705

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001248	2225809	MAG	Austria	Europe

• Gene Location: Start: 2178; End: 3101 Strand: -

Full Sequence      

MKKILFLLLILAGAVYWGFSSGSELTKNVVHEHVKPHAAQKATPKDASPSEEKGIVTEIS
DTVRTLISGLSSSETKEGSVETLPPKPDAKSPVDGAEQLLTAKEKMDNVLHFRKALEARV
HREEFVPFAEIPDYLKKGIVATEDRRFYEHGAMDLIGVARAAFTNYLAGETLQGGSTITQ
QTVKNIFLSNDRTMTRKAEELALAVQLERNYSKEEILELYLNTIYYGHGAYGLKEASRTY
FGKAPKELDLAQCAMLAGLPQAPSAYDPISHPKEGAKRMTVVLALMAEQGIITPTQAASA
AAELWLK

Enzyme Prediction     

No EC number prediction in MGYG000001248_01841.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	121	286	2.9e-68	0.9322033898305084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	3.59e-89	117	287	7	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	1.35e-87	122	305	1	184	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	5.79e-83	122	303	75	257	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	2.45e-77	122	303	66	247	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	2.62e-58	100	293	114	321	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK25656.1	2.56e-117	3	307	2	304
AOH38594.1	3.42e-87	103	307	66	270
ARF99932.1	5.81e-66	93	297	47	255
AXB81629.1	8.21e-64	104	300	52	249
AXL21687.1	2.51e-62	110	300	62	253

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	1.06e-53	120	296	17	193	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	2.12e-53	120	296	17	193	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
5U2G_A	3.40e-40	126	293	43	210	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
3DWK_A	5.89e-39	122	296	26	200	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
4OON_A	8.12e-38	126	292	42	208	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q07259	9.31e-51	115	293	39	216	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
P38050	1.29e-48	124	300	68	244	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
O66874	1.97e-48	120	296	60	236	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
O87626	5.18e-46	106	296	38	241	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
P39793	7.63e-46	113	296	85	269	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.573371	0.386294	0.039379	0.000278	0.000234	0.000443

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001248_01841.