CAZyme Information: MGYG000001249_00322

Basic Information

• Species: Collinsella provencensis
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella provencensis
• CAZyme ID: MGYG000001249_00322
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481	MGYG000001249_6|CGC1	54503.96	4.5463

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001249	1615834	MAG	Austria	Europe

• Gene Location: Start: 17558; End: 19003 Strand: -

Full Sequence      

MSFPDTFLWGGATAANQCEGGWDEGGKGPSVDDVLTAGSHKAPRLITRTIDPELYYPNHV
GNDFYHRYAEDISLMAEMGFKAYRMSIAWSRIFPTGMEDVPNEEGLAFYDKVFDLLHENG
IEPVVTLSHYETPFGLTERHNGWASREVIDLFVRYCDTVFNRYKGKVRYWITFNEINCAF
TPLGNLVSLGMLNGDDDVVRFTEQHDDVRLRYQALHHQFLASARAVKLAHQIDAENMVGN
MINLMTRYPLTCNPADVIAAQHEMQMFDYYCCDVQIRGSYPHFARRLWADNGVELEIAEG
DFETLAEGKVDFCSFSYYMTSCASADPNAESVKGNLVGGKTNPYLEATRWGSQIDPSGLR
YVLNEMYGRYGVPLMIVENGLGAYDVVEEDGSIHDDYRIEYLREHIKAMKTAVEVDGVDL
IGYTPWGWIDLVSAGSGQMEKRYGFVHVDADDQGNGTYDRSRKDSFYWYKKVIASNGEDL
D

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	477	9.1e-148	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15014	PRK15014	0.0	1	480	4	477	6-phospho-beta-glucosidase BglA; Provisional
PRK09589	celA	0.0	1	480	2	476	6-phospho-beta-glucosidase; Reviewed
COG2723	BglB	0.0	1	481	2	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	481	4	478	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	2	481	3	474	cryptic 6-phospho-beta-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK23062.1	1.08e-248	1	481	1	478
BBK62637.1	1.08e-248	1	481	1	478
BBK22869.1	7.25e-247	1	481	1	478
BBK23030.1	7.25e-247	1	481	1	478
QNM13366.1	3.57e-240	1	481	1	478

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XHY_A	3.28e-182	1	480	6	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
6WGD_A	1.25e-174	3	480	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	7.35e-169	4	480	8	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	2.09e-168	4	480	8	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	6.77e-162	4	480	8	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	1.80e-181	1	480	6	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P42973	2.75e-173	2	480	3	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P40740	1.58e-172	3	480	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	5.51e-164	1	481	5	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P24240	9.87e-160	3	481	4	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001249_00322.