CAZyme Information: MGYG000001249_00967

Basic Information

• Species: Collinsella provencensis
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella provencensis
• CAZyme ID: MGYG000001249_00967
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
196		22028.11	4.4328

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001249	1615834	MAG	Austria	Europe

• Gene Location: Start: 1135; End: 1725 Strand: +

Full Sequence      

MNRRVIFLTWFRVLPLAVVLLFGVISYVYSFGPSLLFKAWYPLEHEEKITEAASKYGVDP
YLVAAIIRTESGWDSEAESERGALGLMQLMPETAQDIVVKGYIDGTVYSADNLRDPETNI
EFGCAYLSFLLSYFNGATDKAIAAYNAGMGNVETWTQEGDALHKVIAFPETQAYLVRVNM
AQSRYRELYPEAFASM

Enzyme Prediction     

No EC number prediction in MGYG000001249_00967.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	54	179	3.2e-29	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	2.04e-60	42	184	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.41e-43	41	188	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	3.01e-38	60	178	1	106	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	4.06e-35	49	155	1	102	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	5.34e-35	2	191	89	289	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH69985.1	4.69e-87	7	193	6	192
QIA32839.1	6.33e-85	7	193	6	192
ATP53198.1	2.98e-83	7	193	6	192
QWT18301.1	5.76e-65	23	193	2	172
AEB06732.1	5.91e-62	1	194	1	194

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	6.09e-19	41	178	445	585	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	6.18e-19	41	178	474	614	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	1.53e-18	41	178	445	585	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	1.53e-18	41	178	446	586	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
1SLY_A	2.09e-18	41	186	449	599	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	4.38e-23	46	179	61	176	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	1.00e-21	41	184	1418	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	1.00e-21	41	184	1418	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P0AGC4	3.94e-17	41	186	476	626	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	3.94e-17	41	186	476	626	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996386	0.001352	0.000124	0.000012	0.000007	0.002144

TMHMM  Annotations     

start	end
7	29