CAZyme Information: MGYG000001251_02024

Basic Information

• Species: Lachnoclostridium_A sp002160755
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium_A; Lachnoclostridium_A sp002160755
• CAZyme ID: MGYG000001251_02024
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
676		72887.64	4.0225

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001251	3364070	MAG	Austria	Europe

• Gene Location: Start: 4894; End: 6924 Strand: -

Full Sequence      

MHRHHSWTALALSGLLSVSAVLAPMTAYGAYDKDGSGVYRMEDGTAIENVYARGIDVSHW
KQQIDWNAVAADDVSFVMLGTRYKGDVDPYFRVNAEGAHKAGIALGAYIYSYATTPEMAV
EEADFVLNLIKDYPISYPVAFDVEDNGTLGTLTPAQVSEIINAFCQRIADAGYYPIVYAN
DNWLANKIDLSAIDYDVWVARYGRKPAYEDPVMWQATSSGSISGVEGNTDIDFQFQDFSG
VIPDTLWRTIDGVTYFYKDYAMQKNTWAEDNGSRYFFDENGQTKKGWFLSGSEQYYLDES
TGKMQTGWLQLDGDWYYFAGTGVMATGWNTVGSSQYYLAEDGKMQTGWLESEGTHYYLKP
SGAMATGWASVDGTWYYFGTSGDRKSGWINPDGSWYFLAEDGKMKTGWLEDGGQHYYLND
SGRMMTGWVEYGGAKYYMNGSGVMQTGWISTDGSWYYFDENGKMRKGWVEVDGSWYYMDQ
SGRMQTGWIDLDGARYYLNGAGVMQTGWMNLDSSWYYMGSDGIMQTGLVNVNDVWYYLGA
DGRMVTGLTAVDGKNYYFDPAAGGAMAAGRAVTVDGVTYEAGADGVLSQAADGADGGTQA
GGTDGAGTDGTAGTGNDGNSGNSADGQAGTGSGAADGTNAGDSSASTGGASGAGTDSANQ
TDGGAGAPVGPGAMLQ

Enzyme Prediction     

No EC number prediction in MGYG000001251_02024.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	55	225	1.2e-44	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	3.26e-69	305	504	442	642	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
cd06414	GH25_LytC-like	5.27e-69	53	235	2	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
NF033930	pneumo_PspA	4.39e-68	359	585	436	657	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	2.97e-64	366	553	486	673	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033838	PspC_subgroup_1	6.04e-63	305	504	485	665	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET96139.1	1.48e-108	7	266	10	270
QRV19588.1	1.56e-106	7	267	10	271
ADL06311.1	1.56e-106	7	267	10	271
QQR03194.1	1.24e-103	33	265	81	312
ANU47907.1	1.24e-103	33	265	81	312

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WW5_A	4.80e-13	57	231	281	464	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	1.12e-12	57	231	281	464	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]
4KRU_A	1.49e-12	53	232	21	205	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	6.14e-12	53	232	21	205	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76421	6.26e-12	54	253	69	268	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8FFY2	8.42e-12	54	253	69	268	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
Q8X7H0	8.42e-12	54	253	69	268	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.206785	0.789664	0.001941	0.000690	0.000400	0.000494

TMHMM  Annotations     

start	end
9	31