CAZyme Information: MGYG000001252_00638

Basic Information

• Species: Catenibacillus sp900557175
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Catenibacillus; Catenibacillus sp900557175
• CAZyme ID: MGYG000001252_00638
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
835	MGYG000001252_39|CGC1	95498.09	4.9333

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001252	2417693	MAG	Austria	Europe

• Gene Location: Start: 4117; End: 6624 Strand: -

Full Sequence      

MERFDLNGTWQMYESGGSQKLSAAVPGSVLSVLLAHQEIPDPYDRTNEYEVRERLRGNYT
FERTFELSENWCDRPFGGRTELVCDGLDTIADVYLNGEFLGRADNMHRTWRFDCGGCLKT
TNVLTIKFISPITWIESHPASPGKEISYAACGCMPGSQYIRKAHSMFGWDWGPQLPDMGI
WRNIGLECRHTAELSDVLISQKHEDGSVRLLAAADVTLLTAAEILISLESPDGEMIGEKQ
MSVSKSGRISVEFDIALPRLWWPNGLGEHPLYTVHVKLCDANGQLLEKKQLRIGLRTLTV
SRAQDAWGSEFAFVINGVKIFAMGADYIPEDCVYSRIDRRRMKYLIDTAADSNFNCLRVW
GGGYYPSDDFYDLCDEAGLIVWQDLMYACNIYDLDDAFEENIIAETMDNVRRIRHHACLG
LLCGNNEMEMGWEDWADVSCHCGSLRADYIKQFEYILPKAVKAADAQTFYWPSSPSNGGG
FVSPNDENHGDTHYWDVWHGQKPFSDYRKYYFRFCSEFGFQSFPLLKTVKTFTAPEDRNI
FSKVMESHQKNGAANGKILYYISENFLYPKDFESLLYISQVVQGLAIKYGVEHWRRNRGR
CMGALYWQLNDNWPVASWSSVDYFGRWKVLQYMARKFFGGLLGTIYEEDETIHISAVNDT
MKASSVRVVLRLKNMSLDILDEYELSDVIPALSAKRLGGRAYKDFFKGTDAVEKGDVFAE
AVFYFEDGTRLVQTETFVPYKHLGIKRPNIQISVSEADECYKIELSSDVYTPFVWLDLKE
QDVRFSDNCFHISGREPIVIEAGKTDMITGMYIDIKSFKEQFFVRSLYDTISINE

Enzyme Prediction     

No EC number prediction in MGYG000001252_00638.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	670	8.7e-102	0.651595744680851

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.22e-106	1	805	10	787	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	3.78e-18	747	829	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10340	ebgA	4.15e-12	61	381	113	394	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17786	Mannosidase_ig	5.75e-09	650	742	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam00703	Glyco_hydro_2	1.16e-08	194	296	3	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL13897.1	3.03e-302	2	830	12	855
VCV23589.1	5.47e-301	2	830	5	848
CBL08662.1	5.47e-301	2	830	5	848
QCU02115.1	1.84e-296	1	827	1	824
CBL20579.1	1.96e-294	1	827	1	838

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	5.00e-153	1	800	3	830	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	5.14e-153	1	800	3	830	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	3.66e-152	1	800	1	828	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	3.77e-152	1	800	3	830	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	1.02e-138	10	822	15	838	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q95327	3.26e-122	6	830	25	878	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
Q29444	9.84e-120	6	830	25	878	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1
Q4FZV0	1.91e-112	4	800	23	856	Beta-mannosidase OS=Rattus norvegicus OX=10116 GN=Manba PE=2 SV=1
Q8K2I4	7.41e-110	4	790	23	844	Beta-mannosidase OS=Mus musculus OX=10090 GN=Manba PE=1 SV=1
O00462	2.12e-107	4	790	23	844	Beta-mannosidase OS=Homo sapiens OX=9606 GN=MANBA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001252_00638.