CAZyme Information: MGYG000001253_00265

Basic Information

• Species: Paramuribaculum sp001689535
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp001689535
• CAZyme ID: MGYG000001253_00265
• CAZy Family: GH120
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
755	MGYG000001253_2|CGC2	83437.73	6.6322

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001253	2271514	MAG	Austria	Europe

• Gene Location: Start: 94173; End: 96440 Strand: +

Full Sequence      

MLYIAGMALSAASVCAKEYHVATSGSDTNSGTITSPLKTINAAAIKAYPGDTITVHEGIY
RERVVPPRGGYSDDSRILYRAAPGERVTITGSEPVKNWVKVKDDTWKTTLPNTFFGESNP
FDEQIYGSWYRGKGRPNHTGSVYLNGQRIRETFSLGDVMQPVKDSPRWYAEADGNGGPVL
MNFEWIRPAAGEKMTSMQASVEGGDQAVCIAIINRWPFGYLKDKSVMHFSGVDFGAGTDT
LMFQAATLAKGGIVEMYLDGDKKELLGSAMVTNTGDWEKFEVFPLKMNRSLSGRHDIRFE
LKAPARYLDGKTIIWAQFPDGTDPNKENVEISVRPQVFYPDRTGINYITVRGFTLENAAT
NWAPPSAEQPGLIGPRWAKGWIIEDNVIRNSRCSGISLGRPTFGHAHHYQKLPPQVYPEA
GGGQTREQLLDYFENASWDKNEAGFHIVRNNHIYACGQAGIVGCSGGAFSVIEGNEIHDI
CMGETFEGDEMAGIKLHFANDAVIKDNHIYRTIRGLWLDWGSQGMQITGNLLHDNNHCED
LFVEVCHGPVFVANNIMLSRNGSSMSQGIAYVHNLITGNISGGQDRCAGGRLTYFYEPHG
TTSLGKVPNPGGDLQWYNNILTKDASLRNWDEPGLPIRYSGNIFSDGARPNDADKRASVY
GDTGLDVKLTEKEDGWYLVMNVPLAWDNRSKTKKVTTKMLGKAITPNQPFTNPDGNPLSC
DKDYFGSSRNSSNPYPGPVEINRPGLHEWKVWPKK

Enzyme Prediction     

No EC number prediction in MGYG000001253_00265.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH120	446	535	1.5e-27	0.978021978021978

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04084	CBM6_xylanase-like	4.55e-12	219	308	27	115	Carbohydrate Binding Module 6 (CBM6); many are appended to glycoside hydrolase (GH) family 11 and GH43 xylanase domains. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family domains, including GH3, GH11, and GH43 domains. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB6s belonging to this family are Microbispora bispora GghA, a 1,4-beta-D-glucan glucohydrolase (GH3); Clostridium thermocellum xylanase U (GH11), and Penicillium purpurogenum ABF3, a bifunctional alpha-L-arabinofuranosidase/xylobiohydrolase (GH43). GH3 comprises enzymes with activities including beta-glucosidase (hydrolyzes beta-galactosidase) and beta-xylosidase (hydrolyzes 1,4-beta-D-xylosidase). GH11 family comprises enzymes with xylanase (endo-1,4-beta-xylanase) activity which catalyze the hydrolysis of beta-1,4 bonds of xylan, the major component of hemicelluloses, to generate xylooligosaccharides and xylose. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold.
pfam03422	CBM_6	4.53e-08	219	308	26	115	Carbohydrate binding module (family 6).
pfam13229	Beta_helix	1.61e-07	441	583	6	141	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
smart00606	CBD_IV	7.05e-06	219	299	34	114	Cellulose Binding Domain Type IV.
cd04080	CBM6_cellulase-like	1.11e-04	236	300	68	130	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW10547.1	0.0	12	754	17	761
AOW10546.1	0.0	9	754	14	760
AOW08578.1	0.0	16	754	18	757
ARN56185.1	9.60e-207	16	752	30	753
ARD26815.1	7.09e-198	4	752	11	757

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VST_A	6.02e-127	18	752	2	638	Thecomplex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_B The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_C The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_D The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_A The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_B The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_C The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_D The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_A The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_B The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_C The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_D The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.242271	0.728028	0.028612	0.000582	0.000245	0.000240

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001253_00265.