CAZyme Information: MGYG000001253_00317

Basic Information

• Species: Paramuribaculum sp001689535
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp001689535
• CAZyme ID: MGYG000001253_00317
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
822		93433.72	7.3479

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001253	2271514	MAG	Austria	Europe

• Gene Location: Start: 154143; End: 156611 Strand: +

Full Sequence      

MNRAIFTLLCLVTAFTAFGESETKPAKIFASPDRIRYDGNCMTIDGEDKFVYSAAFHYFR
CPEELWRDRFRKIKEAGFNTVETYVPWNWHERTMPASINDTTHFDFSDLKRWLKIAHEEF
GLYTIVRPGPFICAEFSGGAYPRWLARFRPDGVEGFWLRSAASRHIAWSEHWFKAVCGAL
ADEQITRKPKGGKGIIMIQLENEYDAHWCGGKDRFLKALYKTVRDKGFDVPVFTCLTSEC
RGSADAELSQVFDCDNYYVAQNDAPSCAYRMSALKRRQPDAPGFVTELQGGWFSLVTGTL
SEEHYSDSRHFQAIGLMTMLGGGTGINYYMFFGGTHFAGWGARGMTTSYDYNSAIRESGG
VGEKYLAAKGLGEFIRKYESQLVRSQGGPCRIENAPEELFGGVRRADDGTLFVFLHNTNP
HKHLKGKATLQPGKISLPRKEMYNIDQNGNKVLMNVAGAESSRDSMYVSPITVEYNLDSL
DSKVLVIKPGKTPASGEWWPRKQAEIKRPSKLPEPVRIAAVKRKEDNYGAAKWISLVRPV
SMTDLGVNDFRYSLYRCAVDLSERQALTEKFLLFNMFTRDIVSVTVNGKSVKRLFPENAD
AQTWLTRNCYDRIRNDEYDNRFDVSGALKEGRNEILVVYENLGHAHGYVPMEELSGIREG
GLSVSETAMTHPLEWEYAADVAGITQKWNQPEYDASGWDEVSLDIHSEIPRKGNNIQPSG
KQDGLFTWYRMEFNLPEARKNEWIPWLIRMNASGNGYMWLNGHNIGRHWEAGPQREFYLP
ECWLNFGREKNVLVIGLRQTSNGAFIKSAEIAPYTNAAELRM

Enzyme Prediction     

No EC number prediction in MGYG000001253_00317.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	43	371	2e-83	0.9837133550488599

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	1.57e-76	42	372	2	315	Glycosyl hydrolases family 35.
PLN03059	PLN03059	5.04e-39	1	785	1	702	beta-galactosidase; Provisional
COG1874	GanA	1.49e-23	35	209	1	166	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	1.17e-12	62	224	8	166	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUI47871.1	0.0	2	821	3	829
QUU05629.1	0.0	2	821	3	829
ANQ59332.1	0.0	2	821	3	829
CUA17207.1	0.0	2	821	3	829
QQT29253.1	0.0	7	821	21	838

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAD_A	5.86e-39	34	422	17	379	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
3THC_A	2.49e-37	35	379	11	335	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	3.00e-37	35	379	35	359	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]
3WF3_A	4.01e-37	35	379	35	359	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]
6EON_A	1.69e-36	1	794	1	591	GalactanaseBT0290 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9MAJ7	5.39e-40	35	771	31	665	Beta-galactosidase 5 OS=Arabidopsis thaliana OX=3702 GN=BGAL5 PE=2 SV=1
O19015	6.06e-39	34	379	34	359	Beta-galactosidase OS=Felis catus OX=9685 GN=GLB1 PE=2 SV=1
Q9TRY9	1.08e-38	35	379	35	359	Beta-galactosidase OS=Canis lupus familiaris OX=9615 GN=GLB1 PE=1 SV=3
Q58D55	4.08e-38	34	378	32	356	Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1
Q5R7P4	1.20e-37	35	379	34	358	Beta-galactosidase OS=Pongo abelii OX=9601 GN=GLB1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000248	0.999074	0.000183	0.000167	0.000155	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001253_00317.