CAZyme Information: MGYG000001253_00738

Basic Information

• Species: Paramuribaculum sp001689535
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp001689535
• CAZyme ID: MGYG000001253_00738
• CAZy Family: GH92
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
220	MGYG000001253_6|CGC1	23529.31	6.7518

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001253	2271514	MAG	Austria	Europe

• Gene Location: Start: 39996; End: 40658 Strand: -

Full Sequence      

MRFITISLCAGMMAMAGSVLAVGQQSASDGKRLSDYVNPFIGASTSISEAGAYHGLGKTI
PGSTTPFGMVQLSPNTITGGDNGSGYSHEHTTMEGFAFTQMSGVGWYGDLGNFLVMPTVG
PLHTASGKEANPDAGYRSRYDKQSEEARAGYYSVFLSDYGVRAEATAAPHSGMLRFTYPE
SKESRIQIDLARRVGGTSTWQKVRVVNDHTITGRMECTPE

Enzyme Prediction     

No EC number prediction in MGYG000001253_00738.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17678	Glyco_hydro_92N	8.74e-63	36	213	1	163	Glycosyl hydrolase family 92 N-terminal domain. This domain is found at the N-terminus of family 92 glycosyl hydrolase proteins.
COG3537	COG3537	3.60e-29	1	213	9	201	Putative alpha-1,2-mannosidase [Carbohydrate transport and metabolism].
NF035929	lectin_1	9.03e-20	34	215	8	165	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50988.1	2.86e-106	28	220	26	218
QUT97309.1	7.60e-100	34	220	38	223
QKH99385.1	7.60e-100	34	220	38	223
QRO15032.1	7.60e-100	34	220	38	223
QUT20923.1	7.60e-100	34	220	38	223

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F91_A	7.66e-42	31	213	5	177	Structureof the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_B Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_C Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_D Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_E Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_F Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_G Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_H Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F92_A Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F92_B Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F92_C Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F92_D Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron]
6F8Z_A	5.88e-24	33	213	7	175	Structureof the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F8Z_B Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F8Z_C Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F90_A Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F90_B Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F90_C Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron]
2XSG_A	7.87e-13	57	190	24	163	Structureof the gh92 family glycosyl hydrolase ccman5 [Cellulosimicrobium cellulans],2XSG_B Structure of the gh92 family glycosyl hydrolase ccman5 [Cellulosimicrobium cellulans]
4AQ0_A	7.90e-13	57	190	40	179	Structureof the Gh92 Family Glycosyl Hydrolase Ccman5 in complex with deoxymannojirimycin [Cellulosimicrobium cellulans],4AQ0_B Structure of the Gh92 Family Glycosyl Hydrolase Ccman5 in complex with deoxymannojirimycin [Cellulosimicrobium cellulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O86365	2.15e-13	10	181	11	174	Uncharacterized glycosidase Rv0584 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0584 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000520	0.998595	0.000212	0.000252	0.000221	0.000198

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001253_00738.