CAZyme Information: MGYG000001253_01027

Basic Information

• Species: Paramuribaculum sp001689535
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp001689535
• CAZyme ID: MGYG000001253_01027
• CAZy Family: GH16
• CAZyme Description: Keratan-sulfate endo-1,4-beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
262		30096.31	6.611

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001253	2271514	MAG	Austria	Europe

• Gene Location: Start: 76465; End: 77253 Strand: -

Full Sequence      

MSTRRFLLGVLFSALFFGASAQETQWKLDWMDDFNGPELDTTVWSPIKRGAADWNNTMKD
EPRLFEFRDGCIVLKGMLSNDQKADTLPYVTGGIYTLDKKAFQPGKFEIKARLHGTKGAW
PAIWLKPFEHKKYRWPMGGEIDIMERLNNNHIVYQTVHSNYTHHKGNTKNPPSGATFPID
REGWNVYGVEIHPDKIQFFINGKPTLTYPKVNDGADGQFPFYIPQFLLIDMQLGGAWVGD
VDINDLPVEMEVDWVKYYTPVK

Enzyme Prediction     

No EC number prediction in MGYG000001253_01027.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	30	258	2.4e-52	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	2.82e-68	30	258	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	1.01e-30	32	258	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02182	GH16_Strep_laminarinase_like	1.22e-20	26	259	2	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
pfam00722	Glyco_hydro_16	7.32e-16	79	256	9	168	Glycosyl hydrolases family 16.
cd08024	GH16_CCF	3.30e-14	88	220	98	245	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU62388.1	4.06e-124	7	262	4	265
ASB37132.1	4.06e-124	7	262	4	265
QQR07873.1	4.06e-124	7	262	4	265
ASM67518.1	7.49e-104	10	258	7	255
QUU10246.1	7.49e-104	10	258	7	255

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2R_AAA	2.37e-105	19	258	22	261	ChainAAA, Beta-glycosidase [Bacteroides caccae]
5WUT_A	3.91e-29	27	258	6	234	Crystalstructure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.],5WUT_B Crystal structure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.]
6T2N_AAA	6.37e-29	26	258	52	302	ChainAAA, Glycoside hydrolase family 16 protein [Akkermansia muciniphila],6T2N_BBB Chain BBB, Glycoside hydrolase family 16 protein [Akkermansia muciniphila]
3ILN_A	1.76e-25	26	258	5	247	ChainA, Laminarinase [Rhodothermus marinus],3ILN_B Chain B, Laminarinase [Rhodothermus marinus]
2VY0_A	3.20e-25	25	259	12	260	TheX-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus],2VY0_B The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	3.59e-40	24	258	54	287	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P45798	9.35e-27	1	258	13	282	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
P23903	7.58e-20	27	258	424	679	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
C1IE32	1.05e-13	26	259	20	268	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
Q9Z3Q2	4.74e-11	32	259	224	458	Endo-1,3-1,4-beta-glycanase EglC OS=Rhizobium meliloti (strain 1021) OX=266834 GN=eglC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000242	0.999105	0.000159	0.000189	0.000157	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001253_01027.