CAZyme Information: MGYG000001253_01642

Basic Information

• Species: Paramuribaculum sp001689535
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp001689535
• CAZyme ID: MGYG000001253_01642
• CAZy Family: GH97
• CAZyme Description: Retaining alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
625	MGYG000001253_20|CGC1	69273.34	5.9198

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001253	2271514	MAG	Austria	Europe

• Gene Location: Start: 23595; End: 25472 Strand: -

Full Sequence      

MALPLLVNAQKATVGLSADGGKLNYKVSYNGKTPVPASPLGMKVDNICLGTDIASFSKKT
GAETSYTVKRQDGSSFYVDVREFDDGVALRYRIPADGPKCIYSEQTAVTFPEGTRVWYAS
GPFQYGWIQAYQDRDISKIDDELLAPPATFRLPDGTYAAVTEANLRNFHGAVLFGNNDNS
VNFGYVENKGHVESGTITGMPGNYIHDVVRDYPWIAYPDEKSGEIVTPWRVIMLASDLDG
LVNNTIIGKVADAPDPELFPKGKDTEWIKPGRSVFTWLTEGNNRLSVANHKRYVDGAAEL
GLQSVVVDDGWELWPQTEPEGSAHTKWEYLKDLTDYAAQRGVDIWVWRPSSVRAGNKTDI
GLVDAGERRQFMKKCAETGVKGLKIDFFHTENLFTVNLMEEILKEAARNKLMVIFHGVNK
PTGDNFTYPNLLAKEAVRGLECVGAENSWAPGPAWTYHNTVLPFTRWLAGPADYTPLNFR
AFCPKEISFAHQLASIYTFTSPMLILAADMEDMLSTPGRQFIEEVPVTWDETRVLPESKI
GEIAAIARRSGDIWYLSVLNGGKQYAGNLSTDFLPKGNYRTTIASDKDNDPRQIALTSGK
TKSGRPLKVNLIPGGGYLVKFERTR

Enzyme Prediction     

No EC number prediction in MGYG000001253_01642.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	61	621	4.2e-129	0.849445324881141

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	9.20e-60	264	526	1	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	2.21e-37	11	252	7	234	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	4.21e-22	529	621	1	96	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VDS02726.1	0.0	2	623	14	638
QCQ49590.1	0.0	1	624	12	638
QRM72238.1	0.0	1	624	12	638
QTO25646.1	0.0	1	624	12	638
QCQ33866.1	0.0	1	624	12	638

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A24_A	1.40e-50	20	622	18	641	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
5E1Q_A	1.53e-49	20	622	32	655	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
5XFM_A	6.06e-46	25	618	40	639	Crystalstructure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_B Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_C Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_D Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron]
3WFA_A	4.69e-36	227	625	266	707	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2JKA_A	4.71e-36	227	625	275	716	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D7CFN7	6.91e-54	4	617	40	616	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1
Q8A6L0	1.01e-49	20	622	39	662	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
G8JZS4	2.71e-35	227	625	286	727	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000084	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001253_01642.